Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437ALS5

Protein Details
Accession A0A437ALS5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-30DIQEKERKYKEERNICKKYTHydrophilic
264-289DNITKKFNDSCNKKRNSKEIFLKSNQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
IPR044634  Zuotin/DnaJC2  
Gene Ontology GO:0030544  F:Hsp70 protein binding  
GO:0043022  F:ribosome binding  
GO:0051083  P:'de novo' cotranslational protein folding  
GO:0006450  P:regulation of translational fidelity  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
Amino Acid Sequences MMLQLYYKSEDIQEKERKYKEERNICKKYTLEELKNWRKLDLYFLLDLDSFREKEIPQNVLDFVFKKQIKRYHPDRHGTPKEALFAIQNAYKTLGNPNQRKKFDSVFFDESIPEDRKYDLEEFLEVFGECFKRNAKFSVKQPVPSLGNKDSSREEISEFYIFWENFSSWRIFNFLFETDVTMTSYERRDEEKKIKNQLHKLKVADNLRIIKLVQIALKRDPRINVTKESTVDKRLIGNGWNEEEIECLIKLLNDFKVGEKNRFDNITKKFNDSCNKKRNSKEIFLKSNQINNLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.6
4 0.62
5 0.64
6 0.69
7 0.7
8 0.72
9 0.76
10 0.78
11 0.82
12 0.79
13 0.77
14 0.69
15 0.62
16 0.61
17 0.6
18 0.55
19 0.55
20 0.63
21 0.66
22 0.72
23 0.69
24 0.59
25 0.52
26 0.47
27 0.46
28 0.41
29 0.35
30 0.29
31 0.28
32 0.28
33 0.26
34 0.25
35 0.21
36 0.19
37 0.15
38 0.14
39 0.17
40 0.16
41 0.22
42 0.28
43 0.27
44 0.25
45 0.26
46 0.26
47 0.25
48 0.27
49 0.21
50 0.18
51 0.24
52 0.25
53 0.27
54 0.34
55 0.4
56 0.46
57 0.53
58 0.61
59 0.63
60 0.7
61 0.74
62 0.74
63 0.77
64 0.76
65 0.72
66 0.66
67 0.57
68 0.51
69 0.43
70 0.36
71 0.26
72 0.2
73 0.18
74 0.16
75 0.15
76 0.13
77 0.14
78 0.14
79 0.14
80 0.19
81 0.23
82 0.31
83 0.39
84 0.49
85 0.56
86 0.58
87 0.6
88 0.58
89 0.58
90 0.54
91 0.51
92 0.48
93 0.44
94 0.42
95 0.4
96 0.35
97 0.3
98 0.29
99 0.26
100 0.19
101 0.15
102 0.15
103 0.14
104 0.17
105 0.18
106 0.15
107 0.13
108 0.13
109 0.13
110 0.13
111 0.13
112 0.09
113 0.08
114 0.08
115 0.08
116 0.07
117 0.08
118 0.1
119 0.12
120 0.13
121 0.18
122 0.23
123 0.28
124 0.32
125 0.42
126 0.42
127 0.42
128 0.42
129 0.42
130 0.38
131 0.34
132 0.35
133 0.26
134 0.31
135 0.28
136 0.29
137 0.26
138 0.26
139 0.26
140 0.21
141 0.2
142 0.15
143 0.17
144 0.15
145 0.14
146 0.13
147 0.15
148 0.14
149 0.14
150 0.14
151 0.12
152 0.12
153 0.14
154 0.13
155 0.09
156 0.1
157 0.12
158 0.11
159 0.12
160 0.13
161 0.12
162 0.12
163 0.12
164 0.13
165 0.11
166 0.12
167 0.11
168 0.09
169 0.09
170 0.1
171 0.12
172 0.11
173 0.12
174 0.16
175 0.19
176 0.26
177 0.35
178 0.42
179 0.48
180 0.57
181 0.62
182 0.66
183 0.72
184 0.75
185 0.73
186 0.69
187 0.64
188 0.59
189 0.59
190 0.55
191 0.49
192 0.45
193 0.41
194 0.36
195 0.34
196 0.3
197 0.24
198 0.22
199 0.2
200 0.18
201 0.18
202 0.2
203 0.26
204 0.32
205 0.33
206 0.34
207 0.34
208 0.37
209 0.42
210 0.43
211 0.43
212 0.42
213 0.43
214 0.42
215 0.46
216 0.43
217 0.38
218 0.36
219 0.31
220 0.28
221 0.26
222 0.26
223 0.24
224 0.25
225 0.25
226 0.26
227 0.25
228 0.23
229 0.21
230 0.2
231 0.17
232 0.15
233 0.11
234 0.09
235 0.08
236 0.09
237 0.1
238 0.12
239 0.13
240 0.14
241 0.15
242 0.17
243 0.27
244 0.3
245 0.35
246 0.37
247 0.39
248 0.41
249 0.45
250 0.46
251 0.45
252 0.48
253 0.52
254 0.49
255 0.52
256 0.52
257 0.55
258 0.63
259 0.64
260 0.67
261 0.68
262 0.74
263 0.77
264 0.81
265 0.83
266 0.81
267 0.81
268 0.82
269 0.81
270 0.81
271 0.77
272 0.78
273 0.73
274 0.71
275 0.68