Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AHB1

Protein Details
Accession A0A437AHB1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
35-54NNSNLRKKIKKENQLFSKNKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MLLTDFYIQKYKYKILSDQPYTIVNLEQMHKPEENNSNLRKKIKKENQLFSKNKILKILKELNLNFENTELISNNLEIFVKNLIRNSITKAISKGRKTLFVEDIKESIKEMRLFYLYDLINE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.54
4 0.54
5 0.53
6 0.5
7 0.46
8 0.43
9 0.37
10 0.28
11 0.2
12 0.18
13 0.18
14 0.18
15 0.19
16 0.2
17 0.2
18 0.2
19 0.24
20 0.28
21 0.31
22 0.35
23 0.4
24 0.45
25 0.49
26 0.55
27 0.55
28 0.54
29 0.6
30 0.63
31 0.66
32 0.68
33 0.73
34 0.76
35 0.8
36 0.78
37 0.71
38 0.72
39 0.65
40 0.57
41 0.54
42 0.46
43 0.37
44 0.41
45 0.43
46 0.36
47 0.39
48 0.38
49 0.36
50 0.35
51 0.34
52 0.27
53 0.2
54 0.17
55 0.11
56 0.12
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.06
65 0.07
66 0.08
67 0.1
68 0.11
69 0.12
70 0.13
71 0.15
72 0.16
73 0.2
74 0.25
75 0.25
76 0.26
77 0.28
78 0.35
79 0.42
80 0.43
81 0.45
82 0.41
83 0.47
84 0.49
85 0.51
86 0.5
87 0.48
88 0.49
89 0.45
90 0.45
91 0.38
92 0.34
93 0.3
94 0.25
95 0.25
96 0.24
97 0.23
98 0.24
99 0.24
100 0.25
101 0.25
102 0.29