Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AP34

Protein Details
Accession A0A437AP34   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
2-28SDDSNKNVEVRKRKRKFYKECCAEGCDHydrophilic
104-133KGRFYCKKCSYVPKKKEKDGKKCCSKCLYEHydrophilic
NLS Segment(s)
PositionSequence
14-15RK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
Amino Acid Sequences MSDDSNKNVEVRKRKRKFYKECCAEGCDFSEPFKMVPQKNVNQKEEVKIIKNPIFEEVSRRICKDKKRSNFNCTSCNTGITFYWRDGWDSNIILCNKCGLRFEKGRFYCKKCSYVPKKKEKDGKKCCSKCLYEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.84
3 0.88
4 0.91
5 0.91
6 0.91
7 0.89
8 0.87
9 0.8
10 0.74
11 0.66
12 0.56
13 0.48
14 0.4
15 0.32
16 0.26
17 0.25
18 0.2
19 0.18
20 0.22
21 0.26
22 0.24
23 0.33
24 0.39
25 0.43
26 0.52
27 0.6
28 0.56
29 0.55
30 0.56
31 0.51
32 0.49
33 0.45
34 0.38
35 0.33
36 0.37
37 0.34
38 0.33
39 0.3
40 0.27
41 0.26
42 0.23
43 0.25
44 0.25
45 0.29
46 0.29
47 0.3
48 0.32
49 0.34
50 0.43
51 0.49
52 0.52
53 0.54
54 0.64
55 0.7
56 0.73
57 0.78
58 0.73
59 0.69
60 0.61
61 0.58
62 0.48
63 0.42
64 0.34
65 0.26
66 0.23
67 0.21
68 0.21
69 0.15
70 0.18
71 0.17
72 0.18
73 0.18
74 0.19
75 0.17
76 0.16
77 0.16
78 0.18
79 0.19
80 0.18
81 0.17
82 0.19
83 0.17
84 0.18
85 0.21
86 0.19
87 0.25
88 0.32
89 0.37
90 0.44
91 0.48
92 0.55
93 0.6
94 0.63
95 0.66
96 0.65
97 0.66
98 0.62
99 0.69
100 0.72
101 0.75
102 0.79
103 0.8
104 0.83
105 0.86
106 0.89
107 0.89
108 0.89
109 0.88
110 0.89
111 0.89
112 0.86
113 0.84
114 0.83