Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AMM7

Protein Details
Accession A0A437AMM7    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-37NLYDSKLARKKDKKLSKAFRNMYKKLKHydrophilic
NLS Segment(s)
PositionSequence
18-28ARKKDKKLSKA
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
Amino Acid Sequences VDCSLKTDLYNLYDSKLARKKDKKLSKAFRNMYKKLKISQFEPFRILFRDPLKDMIFVQRSLNEIQKAMQVRFFDTYKIPHLEFKERIKISFYCLDCLEDKDEIRLKIFSILDNAITEFKTNRKNRFFVFRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.34
4 0.37
5 0.44
6 0.52
7 0.6
8 0.67
9 0.77
10 0.77
11 0.82
12 0.87
13 0.86
14 0.89
15 0.87
16 0.86
17 0.85
18 0.82
19 0.8
20 0.77
21 0.7
22 0.66
23 0.66
24 0.59
25 0.53
26 0.56
27 0.54
28 0.49
29 0.48
30 0.42
31 0.36
32 0.36
33 0.34
34 0.28
35 0.24
36 0.26
37 0.24
38 0.27
39 0.27
40 0.25
41 0.24
42 0.27
43 0.25
44 0.22
45 0.22
46 0.18
47 0.19
48 0.2
49 0.22
50 0.15
51 0.14
52 0.13
53 0.16
54 0.17
55 0.16
56 0.17
57 0.14
58 0.15
59 0.18
60 0.17
61 0.15
62 0.15
63 0.17
64 0.18
65 0.2
66 0.19
67 0.21
68 0.24
69 0.29
70 0.33
71 0.35
72 0.41
73 0.39
74 0.39
75 0.38
76 0.35
77 0.34
78 0.36
79 0.32
80 0.26
81 0.26
82 0.28
83 0.25
84 0.26
85 0.24
86 0.19
87 0.19
88 0.21
89 0.25
90 0.23
91 0.24
92 0.23
93 0.2
94 0.24
95 0.24
96 0.2
97 0.19
98 0.19
99 0.18
100 0.19
101 0.19
102 0.15
103 0.15
104 0.15
105 0.13
106 0.19
107 0.28
108 0.35
109 0.43
110 0.49
111 0.54
112 0.58