Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AMB9

Protein Details
Accession A0A437AMB9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-28TSNINSKKYWHPSRHETKEKVKKAEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito_nucl 12.833, cyto_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MGTSNINSKKYWHPSRHETKEKVKKAEKECNTDTLNKEILDEVKEDRSKRMDWMLPEYSQNNFDYFDKKFTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.76
3 0.82
4 0.82
5 0.79
6 0.8
7 0.82
8 0.82
9 0.8
10 0.77
11 0.75
12 0.74
13 0.78
14 0.73
15 0.7
16 0.64
17 0.61
18 0.55
19 0.51
20 0.44
21 0.37
22 0.33
23 0.25
24 0.23
25 0.18
26 0.17
27 0.14
28 0.13
29 0.11
30 0.16
31 0.19
32 0.19
33 0.22
34 0.24
35 0.24
36 0.26
37 0.31
38 0.29
39 0.29
40 0.35
41 0.36
42 0.34
43 0.36
44 0.35
45 0.31
46 0.3
47 0.28
48 0.22
49 0.2
50 0.21
51 0.22
52 0.23