Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AJL8

Protein Details
Accession A0A437AJL8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-35IILTIKKSNSRKKLLRWLYEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039361  Cyclin  
IPR013763  Cyclin-like_dom  
IPR036915  Cyclin-like_sf  
IPR006671  Cyclin_N  
Pfam View protein in Pfam  
PF00134  Cyclin_N  
Amino Acid Sequences MKFILQDITNIKKENIILTIKKSNSRKKLLRWLYEVVTDFKYSTITFTKAVFILDKFIHKKGLNLSNYQLIGISSLYVSAKYEEKNVLSIKDYEVVTDNSFTSKDILSTELEILKILDFNLNFPLPHDYVTESELEKLNIALSKLEKRDLIYGVISYTLEKEDRCEGPYIIYLKSIRILSDILYYGIDKDISFYLSNCINYQCLRLFAEKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.3
4 0.29
5 0.34
6 0.42
7 0.42
8 0.49
9 0.55
10 0.6
11 0.63
12 0.69
13 0.71
14 0.72
15 0.8
16 0.81
17 0.79
18 0.75
19 0.7
20 0.63
21 0.6
22 0.53
23 0.45
24 0.38
25 0.31
26 0.25
27 0.21
28 0.2
29 0.15
30 0.16
31 0.16
32 0.16
33 0.17
34 0.17
35 0.19
36 0.18
37 0.19
38 0.17
39 0.14
40 0.16
41 0.16
42 0.21
43 0.22
44 0.23
45 0.28
46 0.27
47 0.29
48 0.33
49 0.4
50 0.37
51 0.36
52 0.37
53 0.35
54 0.35
55 0.32
56 0.25
57 0.16
58 0.14
59 0.11
60 0.09
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.07
67 0.09
68 0.09
69 0.12
70 0.13
71 0.13
72 0.16
73 0.17
74 0.16
75 0.16
76 0.16
77 0.15
78 0.17
79 0.16
80 0.13
81 0.14
82 0.14
83 0.13
84 0.13
85 0.12
86 0.09
87 0.1
88 0.09
89 0.09
90 0.07
91 0.07
92 0.07
93 0.08
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.08
100 0.08
101 0.06
102 0.06
103 0.05
104 0.07
105 0.06
106 0.07
107 0.09
108 0.1
109 0.1
110 0.1
111 0.14
112 0.12
113 0.13
114 0.13
115 0.12
116 0.13
117 0.14
118 0.14
119 0.11
120 0.12
121 0.12
122 0.12
123 0.1
124 0.09
125 0.09
126 0.09
127 0.09
128 0.09
129 0.11
130 0.16
131 0.18
132 0.2
133 0.19
134 0.2
135 0.23
136 0.22
137 0.21
138 0.17
139 0.15
140 0.14
141 0.14
142 0.12
143 0.09
144 0.09
145 0.09
146 0.1
147 0.09
148 0.12
149 0.16
150 0.17
151 0.19
152 0.21
153 0.19
154 0.2
155 0.25
156 0.24
157 0.2
158 0.22
159 0.21
160 0.19
161 0.23
162 0.21
163 0.17
164 0.17
165 0.17
166 0.14
167 0.17
168 0.17
169 0.13
170 0.13
171 0.13
172 0.13
173 0.13
174 0.13
175 0.09
176 0.1
177 0.11
178 0.13
179 0.13
180 0.13
181 0.15
182 0.19
183 0.21
184 0.2
185 0.21
186 0.21
187 0.21
188 0.25
189 0.24
190 0.23
191 0.25