Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AQ29

Protein Details
Accession A0A437AQ29   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTIKQKPLSRRKSFKYFTPSIHydrophilic
169-192TSEKEKMKKQSLKKNKKPILKDNTHydrophilic
NLS Segment(s)
PositionSequence
173-190EKMKKQSLKKNKKPILKD
196-197KK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014710  RmlC-like_jellyroll  
Amino Acid Sequences MTIKQKPLSRRKSFKYFTPSIPDNVDDFWEVAKDGEIDNELKDDTLEFPESSAINDSSLKFKKEFSIAEAPQDDFIILSEKNESVSEELGDQSLMNELTNKKLANQNLISEGNQNSSNKPNDEDLSNKPNKEELNNKQINEDLSKKGSKLTNQNDILNYDIASNNFSFTSEKEKMKKQSLKKNKKPILKDNTNLSKKKSFLPVKKPNLQINSTIQNSSPNKLNLVRRSSIIKSKSNEILAIIDSKRFXTNLNCHTKLKKINKTEVALVNLSINSKIKDQSCNRNMIITIIKGSIKVDYNDNSFILKAGGICFVEKETVYSIIGNSSNGSVFQIVYVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.75
4 0.71
5 0.7
6 0.64
7 0.57
8 0.56
9 0.49
10 0.41
11 0.36
12 0.31
13 0.23
14 0.2
15 0.17
16 0.14
17 0.12
18 0.11
19 0.11
20 0.1
21 0.09
22 0.1
23 0.12
24 0.12
25 0.12
26 0.13
27 0.12
28 0.11
29 0.11
30 0.1
31 0.1
32 0.13
33 0.15
34 0.13
35 0.14
36 0.16
37 0.16
38 0.16
39 0.17
40 0.14
41 0.13
42 0.16
43 0.16
44 0.23
45 0.26
46 0.28
47 0.26
48 0.27
49 0.3
50 0.33
51 0.33
52 0.31
53 0.38
54 0.36
55 0.4
56 0.41
57 0.37
58 0.32
59 0.31
60 0.24
61 0.14
62 0.13
63 0.11
64 0.09
65 0.08
66 0.1
67 0.1
68 0.11
69 0.11
70 0.12
71 0.1
72 0.11
73 0.11
74 0.1
75 0.1
76 0.09
77 0.09
78 0.08
79 0.06
80 0.07
81 0.07
82 0.06
83 0.1
84 0.1
85 0.13
86 0.16
87 0.16
88 0.17
89 0.22
90 0.24
91 0.28
92 0.29
93 0.27
94 0.29
95 0.3
96 0.28
97 0.26
98 0.25
99 0.2
100 0.21
101 0.21
102 0.18
103 0.23
104 0.25
105 0.23
106 0.24
107 0.25
108 0.23
109 0.24
110 0.26
111 0.26
112 0.32
113 0.35
114 0.33
115 0.31
116 0.32
117 0.31
118 0.32
119 0.36
120 0.33
121 0.4
122 0.44
123 0.43
124 0.41
125 0.41
126 0.38
127 0.33
128 0.3
129 0.22
130 0.22
131 0.22
132 0.22
133 0.24
134 0.25
135 0.26
136 0.32
137 0.35
138 0.4
139 0.42
140 0.44
141 0.4
142 0.39
143 0.35
144 0.26
145 0.21
146 0.13
147 0.11
148 0.09
149 0.1
150 0.09
151 0.08
152 0.08
153 0.08
154 0.08
155 0.08
156 0.16
157 0.19
158 0.23
159 0.26
160 0.32
161 0.36
162 0.45
163 0.52
164 0.52
165 0.59
166 0.67
167 0.75
168 0.78
169 0.84
170 0.82
171 0.82
172 0.81
173 0.8
174 0.79
175 0.75
176 0.7
177 0.68
178 0.7
179 0.7
180 0.65
181 0.59
182 0.53
183 0.47
184 0.48
185 0.48
186 0.47
187 0.48
188 0.58
189 0.64
190 0.67
191 0.74
192 0.75
193 0.72
194 0.68
195 0.61
196 0.54
197 0.47
198 0.45
199 0.39
200 0.34
201 0.28
202 0.31
203 0.31
204 0.29
205 0.3
206 0.24
207 0.26
208 0.31
209 0.38
210 0.36
211 0.4
212 0.4
213 0.36
214 0.41
215 0.41
216 0.43
217 0.42
218 0.41
219 0.38
220 0.42
221 0.45
222 0.41
223 0.37
224 0.31
225 0.26
226 0.21
227 0.23
228 0.18
229 0.16
230 0.15
231 0.15
232 0.16
233 0.16
234 0.15
235 0.21
236 0.3
237 0.37
238 0.41
239 0.47
240 0.47
241 0.54
242 0.64
243 0.64
244 0.64
245 0.63
246 0.68
247 0.68
248 0.69
249 0.69
250 0.63
251 0.57
252 0.48
253 0.41
254 0.33
255 0.26
256 0.24
257 0.19
258 0.16
259 0.14
260 0.15
261 0.19
262 0.21
263 0.3
264 0.36
265 0.45
266 0.49
267 0.54
268 0.52
269 0.51
270 0.48
271 0.43
272 0.4
273 0.3
274 0.26
275 0.22
276 0.22
277 0.19
278 0.2
279 0.19
280 0.19
281 0.19
282 0.22
283 0.24
284 0.27
285 0.29
286 0.29
287 0.26
288 0.23
289 0.22
290 0.17
291 0.14
292 0.11
293 0.1
294 0.13
295 0.12
296 0.13
297 0.13
298 0.14
299 0.15
300 0.14
301 0.15
302 0.14
303 0.15
304 0.16
305 0.16
306 0.15
307 0.17
308 0.18
309 0.16
310 0.15
311 0.14
312 0.14
313 0.14
314 0.15
315 0.12
316 0.11