Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ANF4

Protein Details
Accession A0A437ANF4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
117-142DYKDRDYKERDYKERDHRDKWRGRRRBasic
NLS Segment(s)
PositionSequence
131-142RDHRDKWRGRRR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences MDDEIKLEDELTETSVEVVLDQPTEDKQLPTLNSNNIYDFEIDNMEDKPWNRPGADITDYFNYGFNETTWKKYIAKQREFVGGKKEEDSYKKNDRDYKDRDYRDYRERDHRERDYRDYKDRDYKERDYKERDHRDKWRGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.08
6 0.08
7 0.07
8 0.07
9 0.08
10 0.08
11 0.13
12 0.14
13 0.13
14 0.14
15 0.19
16 0.2
17 0.24
18 0.27
19 0.27
20 0.29
21 0.3
22 0.29
23 0.26
24 0.25
25 0.22
26 0.18
27 0.15
28 0.12
29 0.11
30 0.11
31 0.1
32 0.1
33 0.11
34 0.12
35 0.15
36 0.18
37 0.2
38 0.19
39 0.19
40 0.2
41 0.23
42 0.25
43 0.21
44 0.2
45 0.19
46 0.2
47 0.19
48 0.19
49 0.14
50 0.12
51 0.11
52 0.09
53 0.15
54 0.15
55 0.18
56 0.18
57 0.2
58 0.2
59 0.26
60 0.35
61 0.38
62 0.42
63 0.42
64 0.42
65 0.49
66 0.49
67 0.45
68 0.44
69 0.37
70 0.33
71 0.31
72 0.31
73 0.26
74 0.29
75 0.31
76 0.31
77 0.37
78 0.4
79 0.44
80 0.49
81 0.51
82 0.55
83 0.59
84 0.61
85 0.62
86 0.61
87 0.63
88 0.63
89 0.64
90 0.64
91 0.64
92 0.6
93 0.61
94 0.66
95 0.67
96 0.69
97 0.72
98 0.72
99 0.72
100 0.75
101 0.74
102 0.72
103 0.74
104 0.71
105 0.69
106 0.7
107 0.69
108 0.68
109 0.67
110 0.7
111 0.71
112 0.74
113 0.75
114 0.73
115 0.77
116 0.79
117 0.82
118 0.81
119 0.8
120 0.81
121 0.83
122 0.85