Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AJL7

Protein Details
Accession A0A437AJL7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-33NEKNKATRKGTIRRKVVKSKPQNISTPHydrophilic
NLS Segment(s)
PositionSequence
17-24XKGTIRRK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MPDSTINEKNKATRXXXKGTIRRKVVKSKPQNISTPAEVSNTISSFKKSQMQLSNISSVTLQYEDQAQIYSFPEVKAVFQNKSPICYFVTGKFKIFDMPKENEPKEKEEVIDLDPVKAAAMREMND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.73
4 0.75
5 0.77
6 0.79
7 0.83
8 0.85
9 0.86
10 0.86
11 0.86
12 0.86
13 0.85
14 0.81
15 0.77
16 0.71
17 0.66
18 0.58
19 0.5
20 0.4
21 0.33
22 0.27
23 0.24
24 0.21
25 0.17
26 0.16
27 0.14
28 0.16
29 0.16
30 0.18
31 0.22
32 0.21
33 0.27
34 0.32
35 0.34
36 0.37
37 0.37
38 0.38
39 0.32
40 0.31
41 0.24
42 0.17
43 0.15
44 0.11
45 0.09
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.08
56 0.07
57 0.09
58 0.09
59 0.1
60 0.15
61 0.17
62 0.17
63 0.18
64 0.26
65 0.25
66 0.29
67 0.28
68 0.24
69 0.22
70 0.24
71 0.24
72 0.23
73 0.31
74 0.29
75 0.3
76 0.29
77 0.28
78 0.3
79 0.31
80 0.3
81 0.29
82 0.32
83 0.38
84 0.46
85 0.47
86 0.49
87 0.5
88 0.49
89 0.48
90 0.45
91 0.39
92 0.33
93 0.34
94 0.29
95 0.33
96 0.28
97 0.24
98 0.22
99 0.21
100 0.18
101 0.17
102 0.15
103 0.13