Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VGC6

Protein Details
Accession K1VGC6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
348-375QDPLMPSQADKPRRKRKKDKAAELAEEEHydrophilic
NLS Segment(s)
PositionSequence
358-404KPRRKRKKDKAAELAEEEAEADRRRAEMKRKMQAGAKKGGGLGRRRF
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSRPFNASWQPPSRDIIIVDNGGKGHHVAVQRRPVEGAVGFENIWRKTVPLYLETVYFEALTTTGLTSRHGEVVTRLNDFDAPQPGTLTLEEEQKQIDETLASLEDLFDGGNSLAGAKLSAERDDYYDLVIVLRSPKLNWQFNLTELRGRVPLTFLTKQLLAPFAVLIGEDRGVQGEPAEAVSTIVSDPGVVRAWRRIIGAPVSTSQPSRAATQSRQTSAAPGSPFKQPATPTPRRASPTRNASPDATPRPVTPVRPGAGHHANQPPMSPTPYKKAFVPTMVSSSSRQGSPSEPATNGRRMRESVMTDVTIPPSSPPAIVPSSDSAVPSSDIASSDLPSSQMPMSTQDPLMPSQADKPRRKRKKDKAAELAEEEAEADRRRAEMKRKMQAGAKKGGGLGRRRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.42
4 0.38
5 0.33
6 0.31
7 0.29
8 0.28
9 0.25
10 0.22
11 0.21
12 0.17
13 0.13
14 0.15
15 0.2
16 0.24
17 0.32
18 0.42
19 0.43
20 0.43
21 0.43
22 0.39
23 0.36
24 0.31
25 0.26
26 0.19
27 0.19
28 0.18
29 0.19
30 0.25
31 0.21
32 0.22
33 0.19
34 0.17
35 0.18
36 0.22
37 0.22
38 0.19
39 0.23
40 0.23
41 0.24
42 0.25
43 0.24
44 0.2
45 0.17
46 0.14
47 0.1
48 0.09
49 0.08
50 0.07
51 0.07
52 0.09
53 0.09
54 0.11
55 0.13
56 0.15
57 0.17
58 0.17
59 0.17
60 0.18
61 0.25
62 0.26
63 0.25
64 0.24
65 0.22
66 0.23
67 0.23
68 0.24
69 0.22
70 0.2
71 0.19
72 0.19
73 0.19
74 0.19
75 0.18
76 0.17
77 0.13
78 0.18
79 0.19
80 0.19
81 0.19
82 0.18
83 0.18
84 0.15
85 0.14
86 0.08
87 0.07
88 0.08
89 0.08
90 0.08
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.04
97 0.04
98 0.04
99 0.05
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.04
106 0.08
107 0.08
108 0.09
109 0.11
110 0.11
111 0.13
112 0.15
113 0.15
114 0.13
115 0.12
116 0.11
117 0.1
118 0.09
119 0.08
120 0.08
121 0.1
122 0.1
123 0.09
124 0.16
125 0.24
126 0.29
127 0.29
128 0.33
129 0.32
130 0.35
131 0.41
132 0.34
133 0.3
134 0.26
135 0.27
136 0.22
137 0.22
138 0.19
139 0.14
140 0.16
141 0.19
142 0.2
143 0.19
144 0.2
145 0.2
146 0.2
147 0.19
148 0.18
149 0.12
150 0.11
151 0.1
152 0.08
153 0.07
154 0.06
155 0.05
156 0.04
157 0.05
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.05
164 0.04
165 0.04
166 0.04
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.03
176 0.04
177 0.05
178 0.06
179 0.06
180 0.07
181 0.09
182 0.11
183 0.12
184 0.13
185 0.13
186 0.13
187 0.15
188 0.15
189 0.14
190 0.14
191 0.14
192 0.14
193 0.13
194 0.12
195 0.13
196 0.13
197 0.14
198 0.16
199 0.18
200 0.19
201 0.26
202 0.29
203 0.28
204 0.29
205 0.27
206 0.26
207 0.24
208 0.25
209 0.19
210 0.17
211 0.17
212 0.18
213 0.2
214 0.18
215 0.2
216 0.18
217 0.25
218 0.34
219 0.39
220 0.42
221 0.44
222 0.49
223 0.49
224 0.52
225 0.5
226 0.49
227 0.52
228 0.52
229 0.52
230 0.49
231 0.47
232 0.47
233 0.48
234 0.45
235 0.38
236 0.33
237 0.3
238 0.34
239 0.34
240 0.32
241 0.3
242 0.31
243 0.28
244 0.28
245 0.29
246 0.3
247 0.34
248 0.33
249 0.34
250 0.33
251 0.34
252 0.33
253 0.33
254 0.29
255 0.24
256 0.27
257 0.25
258 0.22
259 0.28
260 0.33
261 0.34
262 0.33
263 0.37
264 0.36
265 0.35
266 0.37
267 0.31
268 0.29
269 0.3
270 0.3
271 0.25
272 0.25
273 0.24
274 0.2
275 0.19
276 0.17
277 0.18
278 0.21
279 0.24
280 0.24
281 0.23
282 0.27
283 0.31
284 0.38
285 0.39
286 0.38
287 0.37
288 0.35
289 0.38
290 0.39
291 0.37
292 0.34
293 0.32
294 0.3
295 0.28
296 0.27
297 0.26
298 0.21
299 0.18
300 0.14
301 0.13
302 0.13
303 0.12
304 0.12
305 0.14
306 0.15
307 0.15
308 0.17
309 0.17
310 0.19
311 0.19
312 0.19
313 0.15
314 0.15
315 0.16
316 0.13
317 0.12
318 0.1
319 0.1
320 0.12
321 0.12
322 0.12
323 0.12
324 0.12
325 0.12
326 0.11
327 0.13
328 0.12
329 0.12
330 0.12
331 0.15
332 0.18
333 0.19
334 0.2
335 0.2
336 0.21
337 0.21
338 0.23
339 0.2
340 0.18
341 0.24
342 0.32
343 0.4
344 0.48
345 0.58
346 0.67
347 0.77
348 0.86
349 0.89
350 0.92
351 0.93
352 0.95
353 0.95
354 0.94
355 0.92
356 0.88
357 0.8
358 0.71
359 0.6
360 0.49
361 0.38
362 0.29
363 0.23
364 0.18
365 0.15
366 0.13
367 0.14
368 0.19
369 0.26
370 0.35
371 0.42
372 0.51
373 0.59
374 0.63
375 0.67
376 0.7
377 0.71
378 0.69
379 0.67
380 0.59
381 0.52
382 0.5
383 0.49
384 0.48