Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VDD7

Protein Details
Accession K1VDD7    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-113LLPTPEQEPRPRPRRRRNAAVKPASQPHydrophilic
405-430GPKGLDNKLRRHRSPTKKSDSGPKKTBasic
NLS Segment(s)
PositionSequence
95-106PRPRPRRRRNAA
407-485KGLDNKLRRHRSPTKKSDSGPKKTNAASKPPAKDKPAGGAKKSDPSRQALPQKAASNRPSKSTPSAAPAKGKTNGKPKP
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015033  HBS1-like_N  
Pfam View protein in Pfam  
PF08938  HBS1_N  
Amino Acid Sequences MESALPLVREKLKDIKPPISDDAIRDSLWHYWFDVDKTVTWLRKEWEKKGKFIPPPPSPILSECAQASNLGHPAERTPGDAGPPKELLPTPEQEPRPRPRRRRNAAVKPASQPQPSAPSPQPPLTALQRLSLARKQAAAGSASASASATPASSAASSAPATRGSTPALDALAKPMSKLALLAQKRREAAAAKEASSSSASTTVSTPVPSPVPPAEQAEAAPVPAKPLSKLAQKMAAARAARAEAASRGPSDGSPAPTTPVPEAAVEPDEPETEMSALFSVVLPVKKSSSAPSTFFSMLTKPPVELPPEKQPSLAHMHIAVRGDLAAAEQRVREAFGPGVESPDDIILRKQDGRVATGGGAHSVEPPKVVREVRVEKPAQEKPVQSEVAAAQSKQAKEQSMAPAAGPKGLDNKLRRHRSPTKKSDSGPKKTNAASKPPAKDKPAGGAKKSDPSRQALPQKAASNRPSKSTPSAAPAKGKTNGKPKPTTSSGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.57
4 0.61
5 0.62
6 0.59
7 0.54
8 0.47
9 0.48
10 0.42
11 0.38
12 0.32
13 0.3
14 0.28
15 0.28
16 0.26
17 0.2
18 0.21
19 0.23
20 0.24
21 0.28
22 0.24
23 0.23
24 0.28
25 0.34
26 0.35
27 0.35
28 0.37
29 0.36
30 0.44
31 0.5
32 0.54
33 0.58
34 0.58
35 0.63
36 0.68
37 0.73
38 0.72
39 0.73
40 0.73
41 0.69
42 0.72
43 0.7
44 0.64
45 0.57
46 0.51
47 0.46
48 0.37
49 0.33
50 0.26
51 0.23
52 0.2
53 0.19
54 0.18
55 0.17
56 0.19
57 0.18
58 0.17
59 0.16
60 0.17
61 0.21
62 0.21
63 0.19
64 0.18
65 0.18
66 0.23
67 0.29
68 0.29
69 0.28
70 0.29
71 0.27
72 0.28
73 0.28
74 0.27
75 0.24
76 0.26
77 0.26
78 0.33
79 0.37
80 0.41
81 0.49
82 0.55
83 0.61
84 0.68
85 0.75
86 0.78
87 0.85
88 0.87
89 0.9
90 0.91
91 0.92
92 0.92
93 0.9
94 0.84
95 0.78
96 0.77
97 0.72
98 0.62
99 0.52
100 0.44
101 0.43
102 0.39
103 0.41
104 0.35
105 0.35
106 0.39
107 0.4
108 0.38
109 0.32
110 0.35
111 0.33
112 0.36
113 0.3
114 0.27
115 0.29
116 0.29
117 0.32
118 0.31
119 0.3
120 0.26
121 0.26
122 0.25
123 0.23
124 0.23
125 0.19
126 0.16
127 0.14
128 0.14
129 0.12
130 0.12
131 0.1
132 0.08
133 0.07
134 0.06
135 0.05
136 0.04
137 0.04
138 0.05
139 0.05
140 0.05
141 0.05
142 0.07
143 0.08
144 0.08
145 0.09
146 0.1
147 0.12
148 0.12
149 0.13
150 0.12
151 0.13
152 0.13
153 0.12
154 0.12
155 0.11
156 0.1
157 0.11
158 0.14
159 0.13
160 0.12
161 0.12
162 0.11
163 0.11
164 0.11
165 0.12
166 0.17
167 0.21
168 0.27
169 0.31
170 0.34
171 0.35
172 0.35
173 0.34
174 0.27
175 0.26
176 0.29
177 0.27
178 0.23
179 0.24
180 0.24
181 0.23
182 0.21
183 0.19
184 0.1
185 0.1
186 0.1
187 0.1
188 0.1
189 0.11
190 0.11
191 0.11
192 0.11
193 0.11
194 0.12
195 0.11
196 0.13
197 0.12
198 0.13
199 0.14
200 0.16
201 0.15
202 0.14
203 0.14
204 0.14
205 0.13
206 0.11
207 0.1
208 0.08
209 0.08
210 0.09
211 0.1
212 0.08
213 0.11
214 0.15
215 0.19
216 0.22
217 0.22
218 0.25
219 0.26
220 0.28
221 0.26
222 0.28
223 0.22
224 0.2
225 0.2
226 0.15
227 0.14
228 0.11
229 0.1
230 0.07
231 0.08
232 0.09
233 0.08
234 0.08
235 0.08
236 0.08
237 0.11
238 0.12
239 0.13
240 0.13
241 0.13
242 0.15
243 0.15
244 0.16
245 0.13
246 0.12
247 0.1
248 0.1
249 0.1
250 0.09
251 0.1
252 0.09
253 0.09
254 0.08
255 0.08
256 0.08
257 0.07
258 0.07
259 0.06
260 0.06
261 0.05
262 0.05
263 0.04
264 0.04
265 0.04
266 0.05
267 0.07
268 0.08
269 0.08
270 0.09
271 0.1
272 0.11
273 0.12
274 0.14
275 0.18
276 0.2
277 0.22
278 0.22
279 0.26
280 0.25
281 0.25
282 0.23
283 0.19
284 0.17
285 0.19
286 0.17
287 0.14
288 0.16
289 0.18
290 0.21
291 0.22
292 0.25
293 0.32
294 0.36
295 0.36
296 0.35
297 0.33
298 0.32
299 0.36
300 0.32
301 0.23
302 0.2
303 0.21
304 0.22
305 0.23
306 0.18
307 0.11
308 0.11
309 0.1
310 0.07
311 0.07
312 0.07
313 0.06
314 0.07
315 0.07
316 0.08
317 0.08
318 0.09
319 0.09
320 0.09
321 0.09
322 0.09
323 0.12
324 0.12
325 0.13
326 0.12
327 0.12
328 0.11
329 0.12
330 0.12
331 0.09
332 0.1
333 0.1
334 0.13
335 0.15
336 0.15
337 0.17
338 0.17
339 0.19
340 0.19
341 0.18
342 0.16
343 0.16
344 0.16
345 0.13
346 0.12
347 0.1
348 0.13
349 0.13
350 0.13
351 0.12
352 0.13
353 0.14
354 0.19
355 0.19
356 0.19
357 0.27
358 0.34
359 0.38
360 0.45
361 0.45
362 0.44
363 0.51
364 0.52
365 0.49
366 0.47
367 0.44
368 0.41
369 0.47
370 0.43
371 0.35
372 0.33
373 0.28
374 0.31
375 0.3
376 0.24
377 0.21
378 0.26
379 0.26
380 0.28
381 0.3
382 0.25
383 0.25
384 0.31
385 0.33
386 0.32
387 0.33
388 0.29
389 0.31
390 0.29
391 0.29
392 0.24
393 0.18
394 0.2
395 0.23
396 0.31
397 0.31
398 0.41
399 0.5
400 0.59
401 0.61
402 0.65
403 0.72
404 0.76
405 0.82
406 0.82
407 0.82
408 0.8
409 0.8
410 0.82
411 0.81
412 0.8
413 0.77
414 0.71
415 0.68
416 0.65
417 0.7
418 0.65
419 0.64
420 0.63
421 0.64
422 0.67
423 0.7
424 0.72
425 0.68
426 0.68
427 0.61
428 0.62
429 0.64
430 0.62
431 0.56
432 0.57
433 0.55
434 0.59
435 0.61
436 0.59
437 0.53
438 0.52
439 0.55
440 0.57
441 0.63
442 0.61
443 0.62
444 0.62
445 0.65
446 0.65
447 0.67
448 0.65
449 0.65
450 0.59
451 0.59
452 0.56
453 0.55
454 0.55
455 0.53
456 0.49
457 0.48
458 0.55
459 0.54
460 0.58
461 0.56
462 0.56
463 0.57
464 0.6
465 0.6
466 0.62
467 0.65
468 0.66
469 0.7
470 0.68
471 0.69