Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1V0X3

Protein Details
Accession K1V0X3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
98-130LVTKVDKAGRKLRKERKNRQKKLRGTAKSKGGABasic
NLS Segment(s)
PositionSequence
103-134DKAGRKLRKERKNRQKKLRGTAKSKGGADKKK
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDPTGPVTIRTSKFITNRLLNRKQFVVTVTHPTRANISRDDLAERLAQLYKSEKERVVVFGLRTKFGGGSSQGFGLVYDDEESQKKFEPKYRLIRNGLVTKVDKAGRKLRKERKNRQKKLRGTAKSKGGADKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.47
4 0.54
5 0.6
6 0.66
7 0.64
8 0.64
9 0.61
10 0.54
11 0.47
12 0.4
13 0.35
14 0.29
15 0.35
16 0.33
17 0.35
18 0.34
19 0.33
20 0.37
21 0.35
22 0.35
23 0.27
24 0.29
25 0.27
26 0.28
27 0.3
28 0.24
29 0.22
30 0.19
31 0.17
32 0.14
33 0.13
34 0.12
35 0.11
36 0.15
37 0.16
38 0.19
39 0.22
40 0.21
41 0.21
42 0.22
43 0.23
44 0.22
45 0.21
46 0.18
47 0.21
48 0.21
49 0.2
50 0.19
51 0.17
52 0.14
53 0.12
54 0.13
55 0.09
56 0.1
57 0.1
58 0.1
59 0.1
60 0.09
61 0.09
62 0.08
63 0.07
64 0.05
65 0.06
66 0.06
67 0.07
68 0.09
69 0.09
70 0.1
71 0.14
72 0.16
73 0.18
74 0.25
75 0.31
76 0.38
77 0.48
78 0.56
79 0.6
80 0.61
81 0.64
82 0.63
83 0.6
84 0.54
85 0.48
86 0.41
87 0.34
88 0.35
89 0.34
90 0.31
91 0.31
92 0.4
93 0.44
94 0.52
95 0.61
96 0.67
97 0.73
98 0.81
99 0.87
100 0.89
101 0.91
102 0.92
103 0.93
104 0.93
105 0.93
106 0.93
107 0.92
108 0.91
109 0.87
110 0.85
111 0.83
112 0.8
113 0.74
114 0.72