Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ANK5

Protein Details
Accession A0A437ANK5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-88IETKKDKQIFYKNRKRLDKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 11.999, cyto 9, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR005314  Peptidase_C50  
Gene Ontology GO:0005634  C:nucleus  
GO:0004197  F:cysteine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF03568  Peptidase_C50  
Amino Acid Sequences MQRMINKTKIKDLYSLFEDLFVRNVLSVHKRGNYLVFTHYPFMLTQKMKITFDLKPILEKSKKTFLMKIETKKDKQIFYKNRKRLDXKIAEKVNELNKMLIFDGVEHLLVGDFEFPFEKCAKLSNCKRIFKLSGLKIDKXPSSIFYVLDPQNKLPKTKERLMPLLKKYDGVVNRPAIQSDIKYTPINLLYFGHGNGQSFLNFKCDTESVYLFGCSSAKRFFFYGSNVHGAVYKYKCXKFIGCLWDISDKDIDLISKEYLVSGNLDRNVSRYEYLSGASVVVYELI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.37
4 0.35
5 0.33
6 0.27
7 0.25
8 0.19
9 0.15
10 0.13
11 0.13
12 0.15
13 0.2
14 0.24
15 0.27
16 0.3
17 0.32
18 0.33
19 0.37
20 0.34
21 0.31
22 0.32
23 0.31
24 0.3
25 0.3
26 0.29
27 0.25
28 0.23
29 0.23
30 0.26
31 0.23
32 0.24
33 0.29
34 0.33
35 0.33
36 0.36
37 0.37
38 0.32
39 0.37
40 0.4
41 0.32
42 0.33
43 0.35
44 0.41
45 0.42
46 0.42
47 0.42
48 0.45
49 0.51
50 0.5
51 0.51
52 0.47
53 0.52
54 0.57
55 0.6
56 0.6
57 0.63
58 0.62
59 0.67
60 0.67
61 0.62
62 0.62
63 0.64
64 0.65
65 0.68
66 0.76
67 0.75
68 0.8
69 0.82
70 0.79
71 0.76
72 0.75
73 0.75
74 0.69
75 0.7
76 0.64
77 0.59
78 0.58
79 0.54
80 0.47
81 0.38
82 0.33
83 0.24
84 0.22
85 0.2
86 0.16
87 0.12
88 0.08
89 0.09
90 0.08
91 0.07
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.07
103 0.08
104 0.08
105 0.08
106 0.13
107 0.16
108 0.25
109 0.33
110 0.41
111 0.49
112 0.52
113 0.54
114 0.53
115 0.52
116 0.48
117 0.49
118 0.43
119 0.44
120 0.45
121 0.45
122 0.43
123 0.42
124 0.38
125 0.31
126 0.28
127 0.2
128 0.18
129 0.16
130 0.13
131 0.2
132 0.21
133 0.23
134 0.23
135 0.23
136 0.28
137 0.29
138 0.3
139 0.26
140 0.32
141 0.35
142 0.41
143 0.44
144 0.43
145 0.5
146 0.55
147 0.59
148 0.54
149 0.54
150 0.47
151 0.43
152 0.39
153 0.37
154 0.32
155 0.28
156 0.29
157 0.25
158 0.27
159 0.27
160 0.26
161 0.22
162 0.2
163 0.18
164 0.17
165 0.17
166 0.17
167 0.17
168 0.17
169 0.18
170 0.2
171 0.19
172 0.16
173 0.15
174 0.14
175 0.14
176 0.14
177 0.15
178 0.13
179 0.13
180 0.14
181 0.13
182 0.12
183 0.13
184 0.13
185 0.14
186 0.14
187 0.13
188 0.15
189 0.15
190 0.16
191 0.18
192 0.19
193 0.15
194 0.16
195 0.16
196 0.13
197 0.14
198 0.13
199 0.1
200 0.12
201 0.15
202 0.15
203 0.17
204 0.17
205 0.19
206 0.21
207 0.24
208 0.26
209 0.25
210 0.28
211 0.26
212 0.26
213 0.26
214 0.24
215 0.28
216 0.27
217 0.32
218 0.3
219 0.34
220 0.36
221 0.35
222 0.37
223 0.34
224 0.41
225 0.35
226 0.38
227 0.36
228 0.41
229 0.4
230 0.4
231 0.36
232 0.25
233 0.23
234 0.19
235 0.17
236 0.13
237 0.15
238 0.12
239 0.12
240 0.12
241 0.12
242 0.12
243 0.12
244 0.13
245 0.14
246 0.19
247 0.21
248 0.23
249 0.22
250 0.24
251 0.26
252 0.26
253 0.25
254 0.21
255 0.21
256 0.21
257 0.22
258 0.2
259 0.18
260 0.15
261 0.13
262 0.11