Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AIG6

Protein Details
Accession A0A437AIG6    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MQKTTQSKKKKSKYRKNKILYNTYGNHydrophilic
67-93NVLEEHKKTKKHKRRVKELKEEMHTKEBasic
NLS Segment(s)
PositionSequence
14-23KKKKSKYRKN
79-90KKTKKHKRRVKE
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MXXXXXXQKTTQSKKKKSKYRKNKILYNTYGNTPVDIIKGSLSKEINLEINEELPGNGQFYCRECDRFFIDLNVLEEHKKTKKHKRRVKELKEEMHTKEMAEFAGGIYNEKLNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.95
3 0.93
4 0.91
5 0.9
6 0.88
7 0.83
8 0.79
9 0.7
10 0.62
11 0.57
12 0.48
13 0.39
14 0.3
15 0.24
16 0.17
17 0.15
18 0.13
19 0.09
20 0.11
21 0.11
22 0.14
23 0.14
24 0.14
25 0.14
26 0.15
27 0.16
28 0.14
29 0.15
30 0.11
31 0.11
32 0.11
33 0.1
34 0.09
35 0.07
36 0.07
37 0.06
38 0.06
39 0.06
40 0.07
41 0.08
42 0.11
43 0.11
44 0.14
45 0.14
46 0.17
47 0.2
48 0.21
49 0.2
50 0.19
51 0.19
52 0.17
53 0.19
54 0.17
55 0.14
56 0.13
57 0.13
58 0.17
59 0.2
60 0.25
61 0.33
62 0.43
63 0.53
64 0.64
65 0.73
66 0.79
67 0.86
68 0.9
69 0.92
70 0.92
71 0.91
72 0.89
73 0.86
74 0.81
75 0.74
76 0.67
77 0.57
78 0.46
79 0.38
80 0.3
81 0.22
82 0.17
83 0.13
84 0.08
85 0.13
86 0.13
87 0.13
88 0.13