Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AQP2

Protein Details
Accession A0A437AQP2    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-47IEENHCQRIKCKKRLRLFIEPSVIKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036885  SWIB_MDM2_dom_sf  
IPR003121  SWIB_MDM2_domain  
Pfam View protein in Pfam  
PF02201  SWIB  
Amino Acid Sequences MNEKLNLLEKQLDDTVLKHRLLIEENHCQRIKCKKRLRLFIEPSVIKTKVINDYVNNVKIHGSDLIKRIFLVEDNLIVNEFLCGENVIDDFYLADDKTHINLVMPSEKSVHENQSYVHNNQLFVHENSLTQVSNSVNQPNSPGKIKERKILIELKDLGVYKLKEKASLLFNKKADTKTNIFIELWKYVHNKKIIKNGKIYCNEELKSILGVEKINIEEVKLINFIEPLDLIHLPSETDIYDIEVELDDLVDFPILYQSKKIPQLTRKINEINEIISMVNEKISVLSEFISKGVRYIDEKCLDDNRSFFYDPCVQEKVYNLINHMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.29
4 0.29
5 0.25
6 0.26
7 0.27
8 0.3
9 0.35
10 0.34
11 0.39
12 0.44
13 0.51
14 0.51
15 0.48
16 0.51
17 0.55
18 0.59
19 0.59
20 0.65
21 0.67
22 0.75
23 0.85
24 0.87
25 0.87
26 0.85
27 0.82
28 0.81
29 0.72
30 0.67
31 0.62
32 0.54
33 0.44
34 0.37
35 0.33
36 0.31
37 0.34
38 0.33
39 0.28
40 0.34
41 0.4
42 0.43
43 0.39
44 0.32
45 0.29
46 0.26
47 0.26
48 0.25
49 0.21
50 0.2
51 0.25
52 0.27
53 0.26
54 0.26
55 0.25
56 0.21
57 0.19
58 0.18
59 0.13
60 0.14
61 0.14
62 0.14
63 0.13
64 0.12
65 0.11
66 0.08
67 0.08
68 0.06
69 0.05
70 0.06
71 0.05
72 0.06
73 0.06
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.07
80 0.06
81 0.06
82 0.07
83 0.07
84 0.08
85 0.09
86 0.09
87 0.08
88 0.1
89 0.12
90 0.16
91 0.16
92 0.16
93 0.17
94 0.17
95 0.2
96 0.21
97 0.24
98 0.2
99 0.2
100 0.2
101 0.27
102 0.31
103 0.28
104 0.31
105 0.27
106 0.27
107 0.27
108 0.29
109 0.24
110 0.2
111 0.22
112 0.17
113 0.16
114 0.16
115 0.17
116 0.13
117 0.09
118 0.11
119 0.09
120 0.11
121 0.13
122 0.15
123 0.14
124 0.14
125 0.18
126 0.19
127 0.21
128 0.21
129 0.21
130 0.25
131 0.34
132 0.36
133 0.38
134 0.38
135 0.38
136 0.39
137 0.43
138 0.38
139 0.35
140 0.34
141 0.29
142 0.28
143 0.27
144 0.23
145 0.2
146 0.19
147 0.14
148 0.19
149 0.18
150 0.17
151 0.18
152 0.21
153 0.23
154 0.31
155 0.35
156 0.35
157 0.35
158 0.37
159 0.39
160 0.38
161 0.36
162 0.32
163 0.3
164 0.29
165 0.3
166 0.29
167 0.26
168 0.25
169 0.24
170 0.21
171 0.19
172 0.17
173 0.2
174 0.21
175 0.26
176 0.3
177 0.33
178 0.34
179 0.45
180 0.5
181 0.5
182 0.56
183 0.56
184 0.58
185 0.6
186 0.59
187 0.53
188 0.5
189 0.46
190 0.39
191 0.34
192 0.27
193 0.21
194 0.17
195 0.14
196 0.1
197 0.1
198 0.09
199 0.1
200 0.09
201 0.11
202 0.1
203 0.09
204 0.1
205 0.1
206 0.11
207 0.1
208 0.1
209 0.08
210 0.09
211 0.09
212 0.07
213 0.07
214 0.06
215 0.08
216 0.08
217 0.08
218 0.08
219 0.08
220 0.08
221 0.08
222 0.08
223 0.06
224 0.06
225 0.06
226 0.07
227 0.07
228 0.07
229 0.07
230 0.06
231 0.07
232 0.06
233 0.06
234 0.04
235 0.04
236 0.05
237 0.04
238 0.04
239 0.04
240 0.09
241 0.1
242 0.11
243 0.13
244 0.16
245 0.23
246 0.3
247 0.36
248 0.38
249 0.45
250 0.55
251 0.63
252 0.65
253 0.65
254 0.64
255 0.6
256 0.57
257 0.51
258 0.42
259 0.32
260 0.28
261 0.21
262 0.16
263 0.16
264 0.11
265 0.1
266 0.08
267 0.08
268 0.07
269 0.09
270 0.09
271 0.08
272 0.09
273 0.1
274 0.11
275 0.12
276 0.14
277 0.13
278 0.13
279 0.15
280 0.17
281 0.19
282 0.23
283 0.31
284 0.33
285 0.35
286 0.37
287 0.41
288 0.42
289 0.41
290 0.38
291 0.35
292 0.35
293 0.35
294 0.32
295 0.32
296 0.37
297 0.37
298 0.41
299 0.39
300 0.35
301 0.36
302 0.39
303 0.38
304 0.35
305 0.34