Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437APW0

Protein Details
Accession A0A437APW0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-24DKPIIIRKKKAPEAHKPKPEDBasic
NLS Segment(s)
PositionSequence
10-22RKKKAPEAHKPKP
Subcellular Location(s) nucl 14.5, cyto_nucl 14, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001387  Cro/C1-type_HTH  
IPR010982  Lambda_DNA-bd_dom_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF01381  HTH_3  
PROSITE View protein in PROSITE  
PS50943  HTH_CROC1  
CDD cd00093  HTH_XRE  
Amino Acid Sequences MYNDKPIIIRKKKAPEAHKPKPEDEEKRNVTVEEGKMITQARNKLNLKQEDLAKKCNVTVAVVSKWEKGQDVFDKKIGAKIGKVLGIKFNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.79
4 0.82
5 0.83
6 0.77
7 0.72
8 0.71
9 0.71
10 0.69
11 0.65
12 0.64
13 0.59
14 0.58
15 0.56
16 0.48
17 0.41
18 0.37
19 0.31
20 0.24
21 0.21
22 0.17
23 0.18
24 0.18
25 0.18
26 0.17
27 0.22
28 0.21
29 0.28
30 0.3
31 0.33
32 0.4
33 0.41
34 0.4
35 0.38
36 0.41
37 0.42
38 0.43
39 0.42
40 0.35
41 0.33
42 0.3
43 0.29
44 0.23
45 0.16
46 0.16
47 0.16
48 0.16
49 0.2
50 0.21
51 0.2
52 0.21
53 0.21
54 0.19
55 0.16
56 0.21
57 0.27
58 0.32
59 0.34
60 0.35
61 0.37
62 0.36
63 0.4
64 0.38
65 0.31
66 0.25
67 0.27
68 0.29
69 0.31
70 0.32
71 0.3