Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AN18

Protein Details
Accession A0A437AN18    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-72ILDNKKRFYTPKKRRKRFKGSKAELQEEBasic
NLS Segment(s)
PositionSequence
50-68KRFYXTPKKRRXKRFKGSK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MNLQTILIFFTIYLLTKIKSTNQKPTDNYVQRKAKILCEFRNKDILDNKKRFYXTPKKRRXKRFKGSKAELQEEISEPIIDSEQFQRVMKLLFEASXYIEEQEISEQKNEEGDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.14
5 0.2
6 0.3
7 0.34
8 0.43
9 0.49
10 0.56
11 0.57
12 0.63
13 0.67
14 0.65
15 0.66
16 0.65
17 0.65
18 0.6
19 0.64
20 0.58
21 0.54
22 0.54
23 0.55
24 0.53
25 0.56
26 0.59
27 0.54
28 0.59
29 0.52
30 0.48
31 0.49
32 0.51
33 0.5
34 0.51
35 0.5
36 0.47
37 0.48
38 0.48
39 0.51
40 0.53
41 0.54
42 0.6
43 0.7
44 0.75
45 0.85
46 0.9
47 0.91
48 0.91
49 0.91
50 0.92
51 0.87
52 0.87
53 0.82
54 0.75
55 0.65
56 0.55
57 0.46
58 0.35
59 0.3
60 0.21
61 0.15
62 0.11
63 0.1
64 0.09
65 0.08
66 0.08
67 0.1
68 0.12
69 0.14
70 0.14
71 0.14
72 0.15
73 0.16
74 0.15
75 0.14
76 0.12
77 0.11
78 0.11
79 0.12
80 0.13
81 0.14
82 0.14
83 0.13
84 0.12
85 0.12
86 0.15
87 0.18
88 0.17
89 0.18
90 0.18
91 0.18