Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AKH4

Protein Details
Accession A0A437AKH4   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
116-136YTTPRLVRLRRDKKKNFNGEVHydrophilic
179-202ELISLKKEENKKKEKKEENGFDNFHydrophilic
NLS Segment(s)
PositionSequence
191-195KKKEK
280-287KKEKRGKK
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR045180  La_dom_prot  
IPR006630  La_HTH  
IPR002344  Lupus_La  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF05383  La  
PROSITE View protein in PROSITE  
PS50961  HTH_LA  
CDD cd07323  LAM  
Amino Acid Sequences MGLSKXKIKKQVEFYFSDANYRFDTFLKETCELDNGFIPISTICKFKNLSSANVTEEDVKEACKDSSVVLIEGNKIKKIITSEYEEYLKCXVDELIVGIKGFDKNLTLEEITTFLEEYTTPRLVRLRRDKKKNFNGEVLVHLPSKEEVEKVLGMKIKFNRSEESKKVKKEEEFLQIMTKNELISLKKEENKKKEKKEENGFDNFLNKLYKYTCNDSIQIRDIKKMVEGIAFVDLKAKCLRFKEVQNFEKKEFTSENKSISLVKMNEEEVKKYFDEIQSNKKEKRGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.54
3 0.57
4 0.5
5 0.43
6 0.38
7 0.35
8 0.31
9 0.24
10 0.29
11 0.25
12 0.28
13 0.31
14 0.3
15 0.3
16 0.3
17 0.32
18 0.27
19 0.26
20 0.23
21 0.18
22 0.17
23 0.15
24 0.15
25 0.11
26 0.14
27 0.13
28 0.14
29 0.13
30 0.18
31 0.2
32 0.2
33 0.3
34 0.29
35 0.33
36 0.35
37 0.37
38 0.35
39 0.35
40 0.34
41 0.28
42 0.25
43 0.23
44 0.18
45 0.17
46 0.15
47 0.15
48 0.15
49 0.13
50 0.13
51 0.1
52 0.15
53 0.15
54 0.15
55 0.14
56 0.15
57 0.17
58 0.22
59 0.23
60 0.19
61 0.18
62 0.18
63 0.18
64 0.2
65 0.22
66 0.2
67 0.26
68 0.27
69 0.3
70 0.33
71 0.31
72 0.29
73 0.25
74 0.21
75 0.14
76 0.12
77 0.09
78 0.06
79 0.07
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.09
88 0.08
89 0.07
90 0.08
91 0.1
92 0.09
93 0.09
94 0.09
95 0.1
96 0.09
97 0.09
98 0.08
99 0.06
100 0.06
101 0.06
102 0.08
103 0.1
104 0.12
105 0.12
106 0.13
107 0.18
108 0.2
109 0.29
110 0.38
111 0.46
112 0.53
113 0.64
114 0.72
115 0.79
116 0.86
117 0.87
118 0.79
119 0.72
120 0.66
121 0.57
122 0.51
123 0.42
124 0.33
125 0.24
126 0.2
127 0.16
128 0.12
129 0.12
130 0.1
131 0.08
132 0.07
133 0.08
134 0.09
135 0.09
136 0.11
137 0.13
138 0.13
139 0.17
140 0.21
141 0.25
142 0.26
143 0.28
144 0.29
145 0.33
146 0.39
147 0.42
148 0.48
149 0.49
150 0.51
151 0.54
152 0.55
153 0.51
154 0.49
155 0.47
156 0.45
157 0.41
158 0.37
159 0.36
160 0.33
161 0.31
162 0.28
163 0.22
164 0.14
165 0.13
166 0.15
167 0.13
168 0.14
169 0.18
170 0.22
171 0.27
172 0.36
173 0.43
174 0.51
175 0.6
176 0.67
177 0.72
178 0.78
179 0.82
180 0.83
181 0.85
182 0.84
183 0.8
184 0.76
185 0.68
186 0.58
187 0.51
188 0.42
189 0.33
190 0.26
191 0.2
192 0.16
193 0.17
194 0.22
195 0.25
196 0.31
197 0.35
198 0.36
199 0.39
200 0.4
201 0.41
202 0.41
203 0.43
204 0.38
205 0.35
206 0.33
207 0.3
208 0.29
209 0.26
210 0.21
211 0.16
212 0.15
213 0.13
214 0.17
215 0.16
216 0.15
217 0.19
218 0.18
219 0.19
220 0.24
221 0.24
222 0.23
223 0.26
224 0.33
225 0.33
226 0.42
227 0.5
228 0.56
229 0.63
230 0.69
231 0.71
232 0.67
233 0.68
234 0.59
235 0.54
236 0.48
237 0.46
238 0.46
239 0.44
240 0.45
241 0.4
242 0.41
243 0.37
244 0.34
245 0.36
246 0.28
247 0.28
248 0.27
249 0.28
250 0.34
251 0.34
252 0.35
253 0.29
254 0.32
255 0.29
256 0.29
257 0.32
258 0.3
259 0.37
260 0.4
261 0.48
262 0.55
263 0.62
264 0.64
265 0.66