Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437APU8

Protein Details
Accession A0A437APU8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
79-101VTLNKNKPKLKLKKSKKASKTIWHydrophilic
NLS Segment(s)
PositionSequence
82-99NKNKPKLKLKKSKKASKT
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
Amino Acid Sequences MLIILYLFCNIVTLETNNNFIIKSYQFPTKIFYVKNNKRISLKNKKEIKPNEYKRSLFLIESIGGDLFKIKSKYRNRFVTLNKNKPKLKLKKSKKASKTIWGIKKETDGYKLTSEGFCLEVNKKGKRIKARVCKSSPYQKFHIEYFETHEMSKKNNLNKVIYLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.21
4 0.21
5 0.21
6 0.2
7 0.18
8 0.2
9 0.16
10 0.18
11 0.19
12 0.25
13 0.27
14 0.27
15 0.31
16 0.32
17 0.36
18 0.33
19 0.4
20 0.44
21 0.51
22 0.6
23 0.61
24 0.6
25 0.6
26 0.67
27 0.68
28 0.68
29 0.69
30 0.69
31 0.74
32 0.75
33 0.79
34 0.79
35 0.77
36 0.77
37 0.77
38 0.77
39 0.74
40 0.7
41 0.62
42 0.59
43 0.52
44 0.41
45 0.32
46 0.24
47 0.18
48 0.18
49 0.15
50 0.1
51 0.09
52 0.08
53 0.08
54 0.06
55 0.09
56 0.11
57 0.12
58 0.21
59 0.31
60 0.4
61 0.48
62 0.54
63 0.55
64 0.6
65 0.65
66 0.67
67 0.68
68 0.7
69 0.68
70 0.68
71 0.66
72 0.66
73 0.7
74 0.68
75 0.69
76 0.69
77 0.73
78 0.76
79 0.84
80 0.87
81 0.85
82 0.84
83 0.78
84 0.76
85 0.75
86 0.74
87 0.72
88 0.67
89 0.61
90 0.52
91 0.52
92 0.46
93 0.39
94 0.34
95 0.28
96 0.26
97 0.26
98 0.25
99 0.23
100 0.19
101 0.18
102 0.14
103 0.14
104 0.12
105 0.13
106 0.14
107 0.2
108 0.26
109 0.29
110 0.35
111 0.38
112 0.44
113 0.52
114 0.6
115 0.63
116 0.68
117 0.74
118 0.78
119 0.78
120 0.78
121 0.76
122 0.77
123 0.75
124 0.7
125 0.66
126 0.64
127 0.62
128 0.57
129 0.55
130 0.47
131 0.4
132 0.41
133 0.42
134 0.36
135 0.33
136 0.36
137 0.31
138 0.32
139 0.4
140 0.39
141 0.4
142 0.46
143 0.51
144 0.5