FuNGI

K1VT83

Protein Details

Accession

K1VT83

Localization Confidence

High

Confidence Score

20.2

NoLS Segment(s)

Position	Sequence	Protein Nature
25-44	LQQFDDFRRRHSRQNREIIT	Hydrophilic
188-215	SAYGSPKRSPKRTPPRKRRRESGLLPRP	Basic
337-356	SVSYKEPSLRKKMRKPDGVG	Hydrophilic

NLS Segment(s)

Position	Sequence
172-208	RRRKSSPLKQFPVLKKSAYGSPKRSPKRTPPRKRRRE
346-350	RKKMR

Subcellular Location(s)

nucl 20, cyto_nucl 13.5, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR011515 Shugoshin_C
Gene Ontology	GO:0000775 C:chromosome, centromeric region GO:0005634 C:nucleus GO:0045132 P:meiotic chromosome segregation
Pfam	View protein in Pfam PF07557 Shugoshin_C

Amino Acid Sequences

MSSHSGPRRRSGGPAPLVDDTTLRLQQFDDFRRRHSRQNREIITDNINRKTAMRNLQDQIEELQAEVLQVRAENSRLHDQVKRMQKESARLRNNAAREALAGILAAVPALTELKQSLDTLSPPPKPISRPNGQMSDRTFINPMATRPAASAAENVGLGILDEVSEPSDSPMRRRKSSPLKQFPVLKKSAYGSPKRSPKRTPPRKRRRESGLLPRPMSPDSDSSLSSPEPEPAVELEPMPEAEESAWEEGSSVLEFRSEAIIDDGGAITPTPGNRLGVKVKDIAAHLASIDIDREAERATPEVKIELDAGADLGASESSRDSEPIEEEGGRSRRARTSVSYKEPSLRKKMRKPDGVGVEDVLGGKRILDTGVRRKSALPRSAAKIGLNDEQIDLLSTSTSTGRAKSRSTTPRATTPTTTPPPSSPKSSPSSKTKRDALGELSSNSIPSVPPKTKRASTASEKTADVPRRAGRRSAAVV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.56
2	0.54
3	0.5
4	0.49
5	0.43
6	0.35
7	0.27
8	0.26
9	0.26
10	0.22
11	0.2
12	0.2
13	0.25
14	0.33
15	0.38
16	0.43
17	0.41
18	0.49
19	0.59
20	0.62
21	0.67
22	0.69
23	0.72
24	0.72
25	0.81
26	0.79
27	0.75
28	0.76
29	0.69
30	0.67
31	0.64
32	0.61
33	0.54
34	0.5
35	0.44
36	0.41
37	0.43
38	0.42
39	0.43
40	0.43
41	0.46
42	0.47
43	0.51
44	0.51
45	0.46
46	0.4
47	0.33
48	0.27
49	0.2
50	0.17
51	0.12
52	0.12
53	0.11
54	0.09
55	0.06
56	0.07
57	0.08
58	0.09
59	0.11
60	0.13
61	0.18
62	0.25
63	0.27
64	0.31
65	0.34
66	0.36
67	0.43
68	0.51
69	0.51
70	0.46
71	0.5
72	0.51
73	0.56
74	0.62
75	0.64
76	0.61
77	0.58
78	0.62
79	0.62
80	0.61
81	0.55
82	0.46
83	0.36
84	0.3
85	0.28
86	0.22
87	0.16
88	0.12
89	0.08
90	0.07
91	0.06
92	0.05
93	0.03
94	0.03
95	0.03
96	0.04
97	0.04
98	0.05
99	0.05
100	0.07
101	0.08
102	0.09
103	0.1
104	0.11
105	0.12
106	0.18
107	0.24
108	0.25
109	0.26
110	0.29
111	0.31
112	0.34
113	0.41
114	0.44
115	0.44
116	0.5
117	0.53
118	0.59
119	0.56
120	0.57
121	0.51
122	0.47
123	0.41
124	0.35
125	0.3
126	0.22
127	0.25
128	0.21
129	0.19
130	0.21
131	0.21
132	0.2
133	0.19
134	0.21
135	0.18
136	0.17
137	0.17
138	0.11
139	0.12
140	0.11
141	0.1
142	0.07
143	0.06
144	0.06
145	0.05
146	0.03
147	0.03
148	0.03
149	0.03
150	0.04
151	0.04
152	0.05
153	0.06
154	0.11
155	0.11
156	0.17
157	0.26
158	0.31
159	0.34
160	0.37
161	0.46
162	0.53
163	0.63
164	0.68
165	0.7
166	0.7
167	0.71
168	0.77
169	0.73
170	0.69
171	0.62
172	0.51
173	0.42
174	0.39
175	0.4
176	0.39
177	0.39
178	0.39
179	0.44
180	0.54
181	0.58
182	0.62
183	0.62
184	0.66
185	0.71
186	0.76
187	0.79
188	0.81
189	0.86
190	0.91
191	0.91
192	0.88
193	0.86
194	0.84
195	0.81
196	0.81
197	0.79
198	0.75
199	0.69
200	0.63
201	0.56
202	0.46
203	0.39
204	0.3
205	0.22
206	0.17
207	0.18
208	0.16
209	0.15
210	0.16
211	0.14
212	0.14
213	0.12
214	0.11
215	0.1
216	0.09
217	0.09
218	0.08
219	0.1
220	0.08
221	0.08
222	0.08
223	0.07
224	0.08
225	0.08
226	0.06
227	0.05
228	0.05
229	0.05
230	0.06
231	0.06
232	0.06
233	0.05
234	0.05
235	0.05
236	0.06
237	0.05
238	0.04
239	0.04
240	0.04
241	0.04
242	0.04
243	0.05
244	0.05
245	0.05
246	0.06
247	0.06
248	0.06
249	0.06
250	0.05
251	0.04
252	0.04
253	0.04
254	0.03
255	0.04
256	0.04
257	0.06
258	0.07
259	0.08
260	0.09
261	0.12
262	0.16
263	0.17
264	0.18
265	0.18
266	0.19
267	0.2
268	0.2
269	0.18
270	0.15
271	0.13
272	0.11
273	0.1
274	0.09
275	0.07
276	0.06
277	0.05
278	0.05
279	0.05
280	0.05
281	0.06
282	0.06
283	0.07
284	0.08
285	0.09
286	0.09
287	0.09
288	0.1
289	0.1
290	0.1
291	0.1
292	0.08
293	0.08
294	0.07
295	0.06
296	0.05
297	0.05
298	0.04
299	0.03
300	0.03
301	0.03
302	0.03
303	0.04
304	0.05
305	0.06
306	0.06
307	0.07
308	0.08
309	0.1
310	0.11
311	0.13
312	0.11
313	0.12
314	0.18
315	0.2
316	0.22
317	0.22
318	0.23
319	0.25
320	0.28
321	0.3
322	0.29
323	0.37
324	0.43
325	0.5
326	0.51
327	0.49
328	0.54
329	0.58
330	0.58
331	0.59
332	0.6
333	0.62
334	0.67
335	0.76
336	0.78
337	0.8
338	0.8
339	0.78
340	0.77
341	0.7
342	0.61
343	0.52
344	0.42
345	0.34
346	0.28
347	0.19
348	0.11
349	0.08
350	0.07
351	0.07
352	0.06
353	0.07
354	0.1
355	0.17
356	0.26
357	0.34
358	0.35
359	0.36
360	0.39
361	0.48
362	0.53
363	0.53
364	0.49
365	0.47
366	0.52
367	0.55
368	0.53
369	0.46
370	0.39
371	0.37
372	0.35
373	0.31
374	0.26
375	0.22
376	0.2
377	0.18
378	0.16
379	0.13
380	0.08
381	0.07
382	0.06
383	0.07
384	0.07
385	0.1
386	0.11
387	0.14
388	0.2
389	0.23
390	0.26
391	0.3
392	0.39
393	0.46
394	0.52
395	0.57
396	0.56
397	0.62
398	0.65
399	0.65
400	0.59
401	0.55
402	0.58
403	0.56
404	0.55
405	0.48
406	0.48
407	0.51
408	0.51
409	0.53
410	0.47
411	0.47
412	0.5
413	0.55
414	0.57
415	0.6
416	0.66
417	0.67
418	0.71
419	0.72
420	0.72
421	0.69
422	0.66
423	0.61
424	0.58
425	0.53
426	0.47
427	0.43
428	0.36
429	0.31
430	0.27
431	0.22
432	0.15
433	0.16
434	0.24
435	0.28
436	0.35
437	0.41
438	0.49
439	0.53
440	0.59
441	0.61
442	0.61
443	0.63
444	0.66
445	0.66
446	0.62
447	0.58
448	0.55
449	0.57
450	0.55
451	0.49
452	0.47
453	0.48
454	0.53
455	0.55
456	0.57
457	0.52

K1VT83

3D AlphaFold-predicted Structure Viewer