Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AHR5

Protein Details
Accession A0A437AHR5   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
124-151NPVTHKEESKRERIRRQRRETNRNITLVHydrophilic
NLS Segment(s)
PositionSequence
136-136R
138-138R
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTSECNEASYVDIKSLIRKFESNKPVKENLSPQKKETPTSKVKQIQKKFQAVQEEKKINTATIIKTSYKPFFSEIKEMFEKNSSSKNYLKKESVKIKKEETTMEEIEEKNNEPVKAKEEILNDNPVTHKEESKRERIRRQRRETNRNITLVSGHLNFILKDKKSDXVIKVSELKDXIVPSNEIENECSKLKYVNYDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.27
4 0.26
5 0.3
6 0.35
7 0.42
8 0.52
9 0.53
10 0.56
11 0.59
12 0.62
13 0.61
14 0.62
15 0.62
16 0.62
17 0.64
18 0.61
19 0.58
20 0.62
21 0.61
22 0.6
23 0.56
24 0.55
25 0.53
26 0.56
27 0.62
28 0.61
29 0.67
30 0.72
31 0.75
32 0.77
33 0.76
34 0.8
35 0.73
36 0.69
37 0.71
38 0.66
39 0.66
40 0.64
41 0.6
42 0.52
43 0.52
44 0.48
45 0.37
46 0.35
47 0.3
48 0.22
49 0.22
50 0.25
51 0.23
52 0.25
53 0.29
54 0.3
55 0.27
56 0.27
57 0.25
58 0.27
59 0.28
60 0.33
61 0.3
62 0.32
63 0.33
64 0.32
65 0.3
66 0.27
67 0.25
68 0.2
69 0.25
70 0.21
71 0.23
72 0.28
73 0.35
74 0.37
75 0.41
76 0.44
77 0.43
78 0.49
79 0.55
80 0.59
81 0.57
82 0.56
83 0.56
84 0.55
85 0.51
86 0.45
87 0.38
88 0.34
89 0.29
90 0.26
91 0.24
92 0.2
93 0.19
94 0.19
95 0.16
96 0.14
97 0.16
98 0.16
99 0.15
100 0.16
101 0.19
102 0.2
103 0.2
104 0.21
105 0.21
106 0.25
107 0.26
108 0.29
109 0.26
110 0.24
111 0.24
112 0.21
113 0.23
114 0.2
115 0.22
116 0.22
117 0.32
118 0.36
119 0.45
120 0.54
121 0.58
122 0.67
123 0.74
124 0.81
125 0.82
126 0.87
127 0.88
128 0.89
129 0.91
130 0.91
131 0.9
132 0.85
133 0.76
134 0.67
135 0.56
136 0.47
137 0.37
138 0.31
139 0.21
140 0.15
141 0.14
142 0.14
143 0.14
144 0.17
145 0.23
146 0.2
147 0.22
148 0.24
149 0.29
150 0.31
151 0.36
152 0.35
153 0.34
154 0.39
155 0.42
156 0.42
157 0.4
158 0.38
159 0.33
160 0.34
161 0.3
162 0.26
163 0.22
164 0.21
165 0.19
166 0.25
167 0.25
168 0.23
169 0.24
170 0.26
171 0.26
172 0.25
173 0.24
174 0.22
175 0.23