Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437APQ2

Protein Details
Accession A0A437APQ2   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-112KLTRAKRLALTPKQQRKREKHMGGYRTTKKBasic
NLS Segment(s)
PositionSequence
73-103DKVLPKELRPKLTRAKRLALTPKQQRKREKH
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MKINVEEIRSKSLEELEVIINELKSEQLRLRQQKNSHSIKPHELKEARRNIARAMTVRTEKLYEQAWNKHKNDKVLPKELRPKLTRAKRLALTPKQQRKREKHMGGYRTTKKIYYSLSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.15
4 0.15
5 0.16
6 0.16
7 0.13
8 0.12
9 0.11
10 0.1
11 0.09
12 0.12
13 0.13
14 0.19
15 0.29
16 0.38
17 0.44
18 0.51
19 0.55
20 0.61
21 0.68
22 0.68
23 0.64
24 0.63
25 0.6
26 0.62
27 0.63
28 0.57
29 0.56
30 0.53
31 0.54
32 0.56
33 0.6
34 0.54
35 0.51
36 0.49
37 0.42
38 0.41
39 0.36
40 0.29
41 0.24
42 0.24
43 0.23
44 0.22
45 0.21
46 0.19
47 0.17
48 0.17
49 0.15
50 0.15
51 0.18
52 0.25
53 0.32
54 0.38
55 0.4
56 0.45
57 0.46
58 0.48
59 0.53
60 0.54
61 0.54
62 0.56
63 0.58
64 0.58
65 0.66
66 0.65
67 0.65
68 0.58
69 0.57
70 0.57
71 0.63
72 0.65
73 0.6
74 0.62
75 0.58
76 0.64
77 0.68
78 0.66
79 0.66
80 0.68
81 0.74
82 0.76
83 0.81
84 0.83
85 0.82
86 0.84
87 0.85
88 0.83
89 0.83
90 0.83
91 0.82
92 0.79
93 0.81
94 0.78
95 0.74
96 0.68
97 0.59
98 0.52
99 0.51