Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AP42

Protein Details
Accession A0A437AP42   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-27NLNSEKKSEDKEKKDLQPNKNRDTLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014939  CDT1_Gemini-bd-like  
IPR036390  WH_DNA-bd_sf  
Pfam View protein in Pfam  
PF08839  CDT1  
Amino Acid Sequences MLNLNSEXXXXKKSEDKEKKDLQPNKNRDTLISNIQFTEIECKNKIAEKERVKLISSMIEKPKITVNDSSFTHNFQLPSHLRKLSKLYTALISIDKFNKSKEIVTIFHNSKKCIENILNQEVSEKDIEILNNVFPESFDFKKVKINYENREIDSFVIDLKERNNKEMDKRLLKLQVLQPKPLFREESTTKKIKKEIKFNEKSLTILERIKLKEKIRKETFIKNNSIDFTELKNKIKQMFLIENRKSIEKVKVIEQCKLYNGNERIDYICKMFTDEFEVKVINKVEYLIYKVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.74
3 0.81
4 0.83
5 0.83
6 0.84
7 0.86
8 0.83
9 0.8
10 0.7
11 0.62
12 0.58
13 0.52
14 0.51
15 0.46
16 0.41
17 0.35
18 0.35
19 0.33
20 0.28
21 0.31
22 0.25
23 0.24
24 0.24
25 0.25
26 0.27
27 0.32
28 0.36
29 0.36
30 0.43
31 0.46
32 0.51
33 0.56
34 0.57
35 0.53
36 0.49
37 0.43
38 0.41
39 0.36
40 0.37
41 0.37
42 0.39
43 0.37
44 0.37
45 0.41
46 0.36
47 0.36
48 0.35
49 0.32
50 0.32
51 0.33
52 0.39
53 0.34
54 0.34
55 0.33
56 0.29
57 0.26
58 0.22
59 0.29
60 0.26
61 0.31
62 0.34
63 0.36
64 0.34
65 0.37
66 0.42
67 0.38
68 0.39
69 0.36
70 0.33
71 0.29
72 0.3
73 0.28
74 0.24
75 0.2
76 0.18
77 0.19
78 0.21
79 0.2
80 0.19
81 0.22
82 0.21
83 0.21
84 0.23
85 0.24
86 0.22
87 0.26
88 0.32
89 0.32
90 0.37
91 0.37
92 0.34
93 0.33
94 0.34
95 0.31
96 0.29
97 0.29
98 0.29
99 0.34
100 0.38
101 0.35
102 0.32
103 0.32
104 0.27
105 0.26
106 0.19
107 0.13
108 0.08
109 0.08
110 0.08
111 0.09
112 0.09
113 0.08
114 0.08
115 0.08
116 0.07
117 0.06
118 0.08
119 0.11
120 0.11
121 0.14
122 0.15
123 0.16
124 0.23
125 0.24
126 0.27
127 0.31
128 0.38
129 0.39
130 0.47
131 0.49
132 0.43
133 0.43
134 0.38
135 0.29
136 0.23
137 0.19
138 0.1
139 0.09
140 0.07
141 0.07
142 0.09
143 0.17
144 0.16
145 0.18
146 0.21
147 0.23
148 0.29
149 0.37
150 0.41
151 0.39
152 0.4
153 0.42
154 0.43
155 0.41
156 0.41
157 0.38
158 0.4
159 0.37
160 0.4
161 0.37
162 0.36
163 0.38
164 0.36
165 0.33
166 0.24
167 0.3
168 0.31
169 0.37
170 0.39
171 0.45
172 0.45
173 0.46
174 0.53
175 0.54
176 0.56
177 0.59
178 0.63
179 0.67
180 0.71
181 0.7
182 0.69
183 0.6
184 0.54
185 0.45
186 0.38
187 0.29
188 0.25
189 0.24
190 0.24
191 0.26
192 0.31
193 0.35
194 0.39
195 0.44
196 0.49
197 0.57
198 0.57
199 0.63
200 0.62
201 0.66
202 0.7
203 0.69
204 0.68
205 0.6
206 0.57
207 0.5
208 0.47
209 0.38
210 0.3
211 0.28
212 0.31
213 0.32
214 0.34
215 0.36
216 0.38
217 0.39
218 0.39
219 0.37
220 0.35
221 0.4
222 0.45
223 0.52
224 0.5
225 0.52
226 0.51
227 0.51
228 0.46
229 0.41
230 0.39
231 0.34
232 0.35
233 0.39
234 0.45
235 0.46
236 0.5
237 0.5
238 0.44
239 0.43
240 0.46
241 0.39
242 0.41
243 0.42
244 0.41
245 0.39
246 0.38
247 0.38
248 0.36
249 0.36
250 0.28
251 0.26
252 0.21
253 0.24
254 0.23
255 0.21
256 0.26
257 0.26
258 0.25
259 0.25
260 0.26
261 0.22
262 0.27
263 0.28
264 0.2
265 0.19
266 0.18
267 0.2
268 0.21