Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AL55

Protein Details
Accession A0A437AL55    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
105-132EYLTPIKLKARKKKCNDKSNKLKNLSTKHydrophilic
NLS Segment(s)
PositionSequence
113-117KARKK
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MIRSLSLFILMRKKCECSCIGFKSKLQRESYLMGPFEQLKIEFDYSLLKRGKQNNYFARKPIIFFKKSRNCKFKFLKRSEHENSRLEEAAKKRKELKVCIKNHSEYLTPIKLKARKKKCNDKSNKLKNLSTKDYILMMKKNCTFEESEEKEQWEEISLNDSEKDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.38
4 0.36
5 0.44
6 0.47
7 0.52
8 0.51
9 0.53
10 0.59
11 0.64
12 0.64
13 0.59
14 0.54
15 0.51
16 0.5
17 0.51
18 0.45
19 0.38
20 0.31
21 0.29
22 0.26
23 0.23
24 0.21
25 0.16
26 0.13
27 0.15
28 0.15
29 0.13
30 0.13
31 0.19
32 0.18
33 0.25
34 0.25
35 0.24
36 0.29
37 0.37
38 0.46
39 0.46
40 0.55
41 0.56
42 0.63
43 0.63
44 0.59
45 0.58
46 0.49
47 0.45
48 0.45
49 0.43
50 0.39
51 0.39
52 0.48
53 0.51
54 0.61
55 0.68
56 0.68
57 0.64
58 0.7
59 0.77
60 0.76
61 0.77
62 0.73
63 0.74
64 0.7
65 0.75
66 0.71
67 0.7
68 0.65
69 0.57
70 0.52
71 0.45
72 0.41
73 0.32
74 0.31
75 0.28
76 0.32
77 0.31
78 0.32
79 0.35
80 0.39
81 0.44
82 0.48
83 0.53
84 0.53
85 0.58
86 0.62
87 0.61
88 0.58
89 0.55
90 0.48
91 0.39
92 0.31
93 0.32
94 0.31
95 0.26
96 0.26
97 0.31
98 0.35
99 0.43
100 0.51
101 0.56
102 0.6
103 0.7
104 0.8
105 0.83
106 0.88
107 0.9
108 0.9
109 0.91
110 0.92
111 0.91
112 0.85
113 0.8
114 0.77
115 0.75
116 0.71
117 0.63
118 0.53
119 0.45
120 0.43
121 0.42
122 0.38
123 0.36
124 0.32
125 0.35
126 0.38
127 0.4
128 0.37
129 0.37
130 0.35
131 0.34
132 0.42
133 0.42
134 0.45
135 0.44
136 0.45
137 0.43
138 0.4
139 0.35
140 0.27
141 0.21
142 0.14
143 0.17
144 0.15
145 0.16
146 0.17