Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AK35

Protein Details
Accession A0A437AK35    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MCKTKKKDLTKENKFNKKKTSIKQNQAANHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7mito 7plas 7mito_nucl 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCKTKKKDLTKENKFNKKKTSIKQNQAANIFEFINDSIFCMLISIIVFNLSSIIEDLMFVKIYIIFKLLNLVFCLKIFTKYTKIKKFLSLLMLYDNFIKIIYLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.86
3 0.85
4 0.84
5 0.82
6 0.8
7 0.81
8 0.81
9 0.83
10 0.83
11 0.8
12 0.76
13 0.7
14 0.62
15 0.52
16 0.43
17 0.33
18 0.25
19 0.2
20 0.14
21 0.11
22 0.09
23 0.09
24 0.07
25 0.07
26 0.07
27 0.06
28 0.05
29 0.05
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.04
39 0.04
40 0.04
41 0.03
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.07
51 0.08
52 0.07
53 0.07
54 0.11
55 0.12
56 0.11
57 0.12
58 0.13
59 0.13
60 0.13
61 0.16
62 0.12
63 0.15
64 0.17
65 0.2
66 0.27
67 0.36
68 0.46
69 0.52
70 0.57
71 0.56
72 0.61
73 0.61
74 0.56
75 0.54
76 0.46
77 0.38
78 0.39
79 0.37
80 0.31
81 0.28
82 0.24
83 0.17
84 0.15