Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AJP5

Protein Details
Accession A0A437AJP5   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
201-229DERLIVESVKRRNKRRKGFYGFKPSKYFDHydrophilic
NLS Segment(s)
PositionSequence
210-217KRRNKRRK
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MHLQLYTPNLRRKFLTLLRKKHSTPIVVYGPPGSGKTTFILKMLEENNLKPVFLDSLPFFPKYLSENEIGYFDCDTPVKLQPNLIIETRFFFYSDSIIFNLNDSMLKKYSLSRNLHNNSFTLPEGEDELIHSIKKIEFENKLIFDGKFTLLNNLFYKNESIKIPKLLSYIHHCYVDFMDINDLYEVIEDFSFLFSTHFFLDERLIVESVKRRNKRRKGFYGFKPSKYFDNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.57
4 0.63
5 0.69
6 0.73
7 0.71
8 0.7
9 0.68
10 0.62
11 0.56
12 0.53
13 0.52
14 0.46
15 0.45
16 0.37
17 0.32
18 0.28
19 0.25
20 0.19
21 0.14
22 0.15
23 0.16
24 0.19
25 0.18
26 0.18
27 0.18
28 0.16
29 0.21
30 0.21
31 0.26
32 0.24
33 0.24
34 0.29
35 0.28
36 0.27
37 0.22
38 0.22
39 0.18
40 0.16
41 0.18
42 0.13
43 0.18
44 0.2
45 0.21
46 0.2
47 0.17
48 0.18
49 0.18
50 0.2
51 0.18
52 0.17
53 0.17
54 0.18
55 0.19
56 0.18
57 0.16
58 0.14
59 0.1
60 0.1
61 0.09
62 0.1
63 0.11
64 0.16
65 0.18
66 0.17
67 0.18
68 0.2
69 0.22
70 0.24
71 0.22
72 0.18
73 0.15
74 0.17
75 0.17
76 0.15
77 0.12
78 0.1
79 0.1
80 0.1
81 0.11
82 0.1
83 0.09
84 0.1
85 0.1
86 0.1
87 0.1
88 0.08
89 0.09
90 0.09
91 0.1
92 0.1
93 0.1
94 0.1
95 0.14
96 0.19
97 0.26
98 0.29
99 0.31
100 0.4
101 0.43
102 0.45
103 0.42
104 0.36
105 0.29
106 0.28
107 0.24
108 0.15
109 0.12
110 0.09
111 0.1
112 0.1
113 0.09
114 0.07
115 0.09
116 0.08
117 0.08
118 0.08
119 0.07
120 0.08
121 0.1
122 0.11
123 0.14
124 0.16
125 0.2
126 0.23
127 0.23
128 0.24
129 0.24
130 0.22
131 0.19
132 0.18
133 0.16
134 0.14
135 0.14
136 0.17
137 0.16
138 0.2
139 0.2
140 0.21
141 0.2
142 0.19
143 0.22
144 0.18
145 0.19
146 0.18
147 0.22
148 0.22
149 0.26
150 0.26
151 0.25
152 0.25
153 0.24
154 0.25
155 0.29
156 0.32
157 0.31
158 0.31
159 0.29
160 0.29
161 0.29
162 0.28
163 0.21
164 0.15
165 0.16
166 0.14
167 0.15
168 0.14
169 0.12
170 0.09
171 0.09
172 0.09
173 0.06
174 0.06
175 0.05
176 0.06
177 0.06
178 0.07
179 0.07
180 0.07
181 0.06
182 0.09
183 0.09
184 0.1
185 0.1
186 0.1
187 0.12
188 0.13
189 0.14
190 0.15
191 0.15
192 0.13
193 0.17
194 0.23
195 0.31
196 0.39
197 0.47
198 0.55
199 0.66
200 0.76
201 0.83
202 0.87
203 0.89
204 0.89
205 0.91
206 0.91
207 0.92
208 0.89
209 0.85
210 0.81
211 0.73