Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437ANU7

Protein Details
Accession A0A437ANU7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
274-302VEVFDSKGYKKRRKSQEHKIEDKNNEQEYHydrophilic
NLS Segment(s)
PositionSequence
287-289KRR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKIGLETEDYQLNLENLQKRFDLLKKEKDILLINEKHKEMDVFIKIKKDSKVKISYFLEEIIVSEEKVEETLLNLLTKLLNFKIILLKGIVVKKMEGEKIRPTIKIYCKNMPYLQIEDELFLDKNNIKLKNELRECFTFVNQSFICEDEILHSLLKTNILAFKNRNTFRICSLNSSFMIYKTNTNKLXXESIFNISPFIDFYAYILKNKSVSPLITDLCEVFFNDFDPILDEAFYNALITFENKGMDCEEEFLRELVKXAPCFFNKGLCADYFSKIVEVFDSKGYKKRRKSQEHKIEDKNNEQEYLERCYGGSLKYYLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.24
4 0.27
5 0.26
6 0.27
7 0.33
8 0.36
9 0.41
10 0.42
11 0.51
12 0.54
13 0.58
14 0.57
15 0.56
16 0.55
17 0.51
18 0.52
19 0.49
20 0.48
21 0.5
22 0.49
23 0.46
24 0.42
25 0.36
26 0.29
27 0.29
28 0.31
29 0.3
30 0.32
31 0.37
32 0.38
33 0.43
34 0.47
35 0.48
36 0.46
37 0.5
38 0.58
39 0.53
40 0.6
41 0.58
42 0.55
43 0.49
44 0.44
45 0.35
46 0.26
47 0.24
48 0.19
49 0.15
50 0.12
51 0.11
52 0.1
53 0.09
54 0.09
55 0.09
56 0.05
57 0.06
58 0.08
59 0.09
60 0.09
61 0.09
62 0.1
63 0.1
64 0.1
65 0.12
66 0.1
67 0.12
68 0.11
69 0.13
70 0.18
71 0.18
72 0.18
73 0.16
74 0.17
75 0.19
76 0.21
77 0.22
78 0.17
79 0.17
80 0.18
81 0.22
82 0.25
83 0.23
84 0.25
85 0.28
86 0.35
87 0.37
88 0.35
89 0.35
90 0.38
91 0.45
92 0.5
93 0.5
94 0.5
95 0.5
96 0.53
97 0.52
98 0.49
99 0.43
100 0.36
101 0.32
102 0.27
103 0.25
104 0.21
105 0.2
106 0.16
107 0.13
108 0.1
109 0.11
110 0.09
111 0.13
112 0.18
113 0.2
114 0.19
115 0.25
116 0.3
117 0.37
118 0.42
119 0.39
120 0.39
121 0.38
122 0.4
123 0.35
124 0.32
125 0.27
126 0.22
127 0.26
128 0.21
129 0.21
130 0.18
131 0.18
132 0.17
133 0.13
134 0.12
135 0.08
136 0.1
137 0.09
138 0.09
139 0.08
140 0.08
141 0.08
142 0.09
143 0.07
144 0.06
145 0.11
146 0.12
147 0.14
148 0.15
149 0.2
150 0.29
151 0.3
152 0.32
153 0.3
154 0.31
155 0.32
156 0.38
157 0.33
158 0.3
159 0.31
160 0.31
161 0.28
162 0.29
163 0.26
164 0.19
165 0.21
166 0.16
167 0.2
168 0.21
169 0.28
170 0.27
171 0.28
172 0.29
173 0.28
174 0.3
175 0.25
176 0.28
177 0.22
178 0.21
179 0.21
180 0.2
181 0.18
182 0.15
183 0.15
184 0.09
185 0.07
186 0.07
187 0.14
188 0.14
189 0.16
190 0.16
191 0.16
192 0.17
193 0.18
194 0.2
195 0.14
196 0.14
197 0.16
198 0.19
199 0.18
200 0.18
201 0.18
202 0.15
203 0.14
204 0.14
205 0.11
206 0.08
207 0.08
208 0.08
209 0.09
210 0.08
211 0.07
212 0.1
213 0.1
214 0.09
215 0.09
216 0.08
217 0.08
218 0.08
219 0.08
220 0.06
221 0.05
222 0.05
223 0.05
224 0.07
225 0.08
226 0.09
227 0.1
228 0.1
229 0.11
230 0.12
231 0.13
232 0.12
233 0.13
234 0.13
235 0.13
236 0.14
237 0.14
238 0.13
239 0.12
240 0.15
241 0.16
242 0.2
243 0.2
244 0.21
245 0.25
246 0.29
247 0.29
248 0.29
249 0.3
250 0.28
251 0.29
252 0.27
253 0.27
254 0.27
255 0.28
256 0.27
257 0.22
258 0.21
259 0.19
260 0.19
261 0.16
262 0.15
263 0.15
264 0.19
265 0.23
266 0.24
267 0.32
268 0.41
269 0.48
270 0.56
271 0.65
272 0.7
273 0.77
274 0.85
275 0.89
276 0.9
277 0.91
278 0.91
279 0.91
280 0.89
281 0.85
282 0.84
283 0.81
284 0.72
285 0.63
286 0.54
287 0.5
288 0.44
289 0.44
290 0.37
291 0.29
292 0.26
293 0.27
294 0.29
295 0.24
296 0.25
297 0.19