Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437ALT0

Protein Details
Accession A0A437ALT0    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
188-215AEGFLKAKKEIKRRGRRANPNKSVNEENHydrophilic
221-240DSQSVTGERKRGRKKKEVTEBasic
NLS Segment(s)
PositionSequence
193-206KAKKEIKRRGRRAN
229-236RKRGRKKK
Subcellular Location(s) plas 11, E.R. 7, pero 3, golg 3, nucl 1, mito 1, cyto 1, cyto_nucl 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTFLNLITKEKIADSIIPISIIGAVINTGYTLKDKNFDNEFSNFIVPSFLLFFSAPLSANIIYKQMLIDSYLVMYYLAGVFLFFMLRDVIYARKICFIFPIILRLNFLLGLKDVNQPISLIFMYMTFCEFNSLILRKMFLEGGRLNFKNRELKGLIENIIVTYLIRNFSLPNYSVYSLIVVLEHLHFAEGFLKAKKEIKRRGRRANPNKSVNEENKTVLEDSQSVTGERKRGRKKKEVTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.2
4 0.19
5 0.18
6 0.16
7 0.14
8 0.12
9 0.08
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.05
16 0.05
17 0.07
18 0.1
19 0.11
20 0.16
21 0.18
22 0.24
23 0.28
24 0.3
25 0.32
26 0.31
27 0.33
28 0.31
29 0.3
30 0.23
31 0.19
32 0.17
33 0.13
34 0.12
35 0.11
36 0.09
37 0.09
38 0.09
39 0.09
40 0.1
41 0.11
42 0.1
43 0.09
44 0.12
45 0.1
46 0.11
47 0.12
48 0.12
49 0.11
50 0.11
51 0.1
52 0.08
53 0.08
54 0.08
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.06
61 0.05
62 0.05
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.04
70 0.03
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.07
77 0.1
78 0.12
79 0.12
80 0.16
81 0.16
82 0.16
83 0.17
84 0.17
85 0.16
86 0.15
87 0.21
88 0.18
89 0.18
90 0.18
91 0.17
92 0.15
93 0.13
94 0.13
95 0.08
96 0.06
97 0.06
98 0.08
99 0.1
100 0.1
101 0.1
102 0.1
103 0.1
104 0.09
105 0.1
106 0.08
107 0.06
108 0.06
109 0.06
110 0.06
111 0.06
112 0.07
113 0.05
114 0.05
115 0.07
116 0.07
117 0.08
118 0.11
119 0.12
120 0.13
121 0.13
122 0.14
123 0.12
124 0.13
125 0.13
126 0.1
127 0.13
128 0.13
129 0.16
130 0.22
131 0.22
132 0.23
133 0.24
134 0.28
135 0.31
136 0.3
137 0.32
138 0.27
139 0.28
140 0.29
141 0.3
142 0.28
143 0.2
144 0.2
145 0.14
146 0.14
147 0.12
148 0.08
149 0.06
150 0.07
151 0.07
152 0.07
153 0.08
154 0.08
155 0.09
156 0.13
157 0.13
158 0.14
159 0.17
160 0.18
161 0.18
162 0.17
163 0.17
164 0.13
165 0.13
166 0.1
167 0.06
168 0.07
169 0.07
170 0.07
171 0.06
172 0.06
173 0.06
174 0.06
175 0.09
176 0.09
177 0.11
178 0.13
179 0.14
180 0.17
181 0.23
182 0.3
183 0.38
184 0.47
185 0.56
186 0.65
187 0.74
188 0.83
189 0.88
190 0.92
191 0.93
192 0.94
193 0.93
194 0.91
195 0.85
196 0.8
197 0.78
198 0.74
199 0.68
200 0.59
201 0.52
202 0.44
203 0.42
204 0.37
205 0.28
206 0.24
207 0.2
208 0.19
209 0.2
210 0.19
211 0.18
212 0.21
213 0.24
214 0.29
215 0.35
216 0.43
217 0.51
218 0.59
219 0.68
220 0.74