Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AJ91

Protein Details
Accession A0A437AJ91    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
85-111GVPPQNKLNELRKRKERREKAETKLSEHydrophilic
321-342VERYLECRKKGKQTLDNFFKKGHydrophilic
NLS Segment(s)
PositionSequence
97-106RKRKERREKA
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036279  5-3_exonuclease_C_sf  
IPR023426  Flap_endonuc  
IPR008918  HhH2  
IPR029060  PIN-like_dom_sf  
IPR006086  XPG-I_dom  
IPR006084  XPG/Rad2  
IPR006085  XPG_DNA_repair_N  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0008409  F:5'-3' exonuclease activity  
GO:0017108  F:5'-flap endonuclease activity  
GO:0003677  F:DNA binding  
GO:0000287  F:magnesium ion binding  
GO:0006284  P:base-excision repair  
GO:0043137  P:DNA replication, removal of RNA primer  
Pfam View protein in Pfam  
PF00867  XPG_I  
PF00752  XPG_N  
CDD cd09867  PIN_FEN1  
Amino Acid Sequences MGISNLAKLIQSXVKKGYRERNLEYYLNKRIAIDGSMCIYQFLIAIRTEGNVLGTEDNTTSHIVGMFYRTIGMVESGIKPVFVFDGVPPQNKLNELRKRKERREKAETKLSEAKETGNKEDIEMYEKRKVKVTKEHVDDCKKVLELLKVPYITAPSEAEAYCAFLNKIKAVDAVASEDMXTLTFGAPLLLRNVFSSKSKKLPVKEFNLSEILKELNLTQNEFIDLCILLGSDFCSTIKGVGPKTALSLINKHRNIENIIQNEKLDIEENFNFEDARLIFQELSKGEKEIEIGGIKWDEINLEEIKEFLVKKHNFNEERVVKAVERYLECRKKGKQXTLDNFFKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.6
4 0.63
5 0.66
6 0.68
7 0.69
8 0.69
9 0.65
10 0.63
11 0.63
12 0.61
13 0.56
14 0.5
15 0.42
16 0.39
17 0.35
18 0.31
19 0.26
20 0.19
21 0.19
22 0.2
23 0.19
24 0.17
25 0.15
26 0.13
27 0.12
28 0.11
29 0.1
30 0.09
31 0.1
32 0.1
33 0.11
34 0.11
35 0.1
36 0.1
37 0.09
38 0.1
39 0.1
40 0.1
41 0.11
42 0.1
43 0.11
44 0.12
45 0.12
46 0.1
47 0.1
48 0.11
49 0.1
50 0.1
51 0.12
52 0.11
53 0.1
54 0.1
55 0.1
56 0.09
57 0.09
58 0.09
59 0.07
60 0.09
61 0.1
62 0.12
63 0.12
64 0.12
65 0.11
66 0.11
67 0.1
68 0.08
69 0.08
70 0.06
71 0.17
72 0.19
73 0.22
74 0.23
75 0.24
76 0.25
77 0.27
78 0.32
79 0.32
80 0.4
81 0.47
82 0.54
83 0.64
84 0.72
85 0.81
86 0.86
87 0.86
88 0.86
89 0.87
90 0.87
91 0.84
92 0.84
93 0.75
94 0.71
95 0.68
96 0.59
97 0.51
98 0.43
99 0.39
100 0.34
101 0.36
102 0.31
103 0.28
104 0.27
105 0.24
106 0.26
107 0.23
108 0.22
109 0.22
110 0.23
111 0.27
112 0.3
113 0.3
114 0.35
115 0.38
116 0.39
117 0.47
118 0.52
119 0.53
120 0.56
121 0.62
122 0.63
123 0.66
124 0.61
125 0.52
126 0.45
127 0.36
128 0.31
129 0.27
130 0.23
131 0.19
132 0.21
133 0.23
134 0.21
135 0.21
136 0.2
137 0.18
138 0.15
139 0.13
140 0.11
141 0.08
142 0.1
143 0.09
144 0.1
145 0.09
146 0.1
147 0.09
148 0.09
149 0.08
150 0.09
151 0.1
152 0.09
153 0.1
154 0.09
155 0.09
156 0.09
157 0.09
158 0.07
159 0.08
160 0.08
161 0.07
162 0.07
163 0.06
164 0.06
165 0.06
166 0.05
167 0.04
168 0.03
169 0.03
170 0.04
171 0.04
172 0.05
173 0.06
174 0.06
175 0.06
176 0.07
177 0.09
178 0.1
179 0.13
180 0.18
181 0.2
182 0.25
183 0.31
184 0.35
185 0.39
186 0.47
187 0.51
188 0.54
189 0.57
190 0.52
191 0.49
192 0.49
193 0.43
194 0.34
195 0.27
196 0.21
197 0.14
198 0.13
199 0.12
200 0.12
201 0.13
202 0.14
203 0.13
204 0.13
205 0.14
206 0.14
207 0.13
208 0.08
209 0.07
210 0.06
211 0.05
212 0.05
213 0.04
214 0.04
215 0.05
216 0.05
217 0.05
218 0.05
219 0.06
220 0.06
221 0.08
222 0.11
223 0.13
224 0.14
225 0.17
226 0.18
227 0.17
228 0.19
229 0.22
230 0.21
231 0.19
232 0.26
233 0.31
234 0.4
235 0.41
236 0.41
237 0.39
238 0.4
239 0.43
240 0.43
241 0.41
242 0.37
243 0.39
244 0.38
245 0.36
246 0.34
247 0.29
248 0.23
249 0.17
250 0.12
251 0.15
252 0.15
253 0.16
254 0.17
255 0.16
256 0.16
257 0.14
258 0.17
259 0.12
260 0.13
261 0.13
262 0.14
263 0.14
264 0.15
265 0.19
266 0.15
267 0.19
268 0.17
269 0.17
270 0.16
271 0.17
272 0.17
273 0.14
274 0.17
275 0.14
276 0.13
277 0.15
278 0.15
279 0.14
280 0.13
281 0.12
282 0.09
283 0.09
284 0.13
285 0.11
286 0.12
287 0.12
288 0.12
289 0.12
290 0.15
291 0.15
292 0.14
293 0.23
294 0.25
295 0.32
296 0.39
297 0.49
298 0.49
299 0.52
300 0.6
301 0.55
302 0.56
303 0.52
304 0.48
305 0.38
306 0.38
307 0.39
308 0.34
309 0.33
310 0.34
311 0.42
312 0.48
313 0.51
314 0.57
315 0.6
316 0.65
317 0.7
318 0.75
319 0.74
320 0.76
321 0.82
322 0.85
323 0.85