Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A437AN21

Protein Details
Accession A0A437AN21    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-36LTEKVIERIRKINRRRAKKEEKEYENDNKRGBasic
NLS Segment(s)
PositionSequence
13-25RIRKINRRRAKKE
Subcellular Location(s) nucl 14, mito 7.5, cyto_mito 5, E.R. 2, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR003959  ATPase_AAA_core  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0016020  C:membrane  
GO:0000502  C:proteasome complex  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
Amino Acid Sequences MTIKRLTEKVIERIRKINRRRAKKEEKEYENDNKRGIFDWIINIVLIAAAIGSLGYMIYIIYMMKKTNKGLEVTTNAAQYGEAKKEFEVFDADNFSSIKYYGKEEILEEMIMKIRTLEILASNETDSYIRSAIQNTSRNFILYGPPGTGKTFVVKKLAYELSRALKLDEKKRTMSKENYNSWVRXCNYVDDLQKMPNKVQVSFIDSASILSKFVGDSEKTLKNLFDWARAESKNVYKIIFIDEVDTFMAGDRNSASEHTLSLKNLFLSILDGANTDARKSKVIFIGSTNRYKDIGSEFKRRFAQKFYFGLPTSLERRHLIFDMLKDAEVSNFYNINEIEKFAESSNNLPHSIIINLVNKMIMSIKISGKKFDANKMAEILSGEAKTYNKGKKAEDDKPVAGEHQNEFDKHIKDHIDGKLYKEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.77
4 0.78
5 0.78
6 0.81
7 0.87
8 0.89
9 0.9
10 0.9
11 0.92
12 0.92
13 0.9
14 0.85
15 0.84
16 0.84
17 0.82
18 0.75
19 0.67
20 0.57
21 0.5
22 0.46
23 0.41
24 0.33
25 0.25
26 0.25
27 0.24
28 0.23
29 0.21
30 0.19
31 0.15
32 0.12
33 0.1
34 0.05
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.03
47 0.04
48 0.06
49 0.08
50 0.11
51 0.16
52 0.2
53 0.22
54 0.28
55 0.31
56 0.32
57 0.33
58 0.37
59 0.36
60 0.37
61 0.37
62 0.31
63 0.28
64 0.25
65 0.23
66 0.2
67 0.2
68 0.2
69 0.19
70 0.19
71 0.19
72 0.23
73 0.23
74 0.21
75 0.21
76 0.17
77 0.18
78 0.21
79 0.2
80 0.18
81 0.18
82 0.17
83 0.14
84 0.13
85 0.14
86 0.11
87 0.15
88 0.16
89 0.18
90 0.18
91 0.18
92 0.21
93 0.19
94 0.18
95 0.15
96 0.13
97 0.15
98 0.14
99 0.13
100 0.1
101 0.09
102 0.09
103 0.09
104 0.09
105 0.08
106 0.1
107 0.12
108 0.12
109 0.12
110 0.12
111 0.12
112 0.11
113 0.09
114 0.09
115 0.08
116 0.08
117 0.09
118 0.11
119 0.15
120 0.22
121 0.28
122 0.28
123 0.3
124 0.3
125 0.29
126 0.28
127 0.25
128 0.21
129 0.17
130 0.17
131 0.15
132 0.16
133 0.16
134 0.17
135 0.17
136 0.13
137 0.16
138 0.18
139 0.18
140 0.22
141 0.21
142 0.2
143 0.25
144 0.28
145 0.24
146 0.23
147 0.25
148 0.24
149 0.26
150 0.26
151 0.21
152 0.22
153 0.28
154 0.34
155 0.38
156 0.38
157 0.41
158 0.46
159 0.5
160 0.52
161 0.54
162 0.56
163 0.57
164 0.58
165 0.6
166 0.61
167 0.56
168 0.51
169 0.46
170 0.37
171 0.29
172 0.28
173 0.23
174 0.23
175 0.26
176 0.25
177 0.25
178 0.29
179 0.31
180 0.29
181 0.28
182 0.26
183 0.23
184 0.22
185 0.23
186 0.19
187 0.22
188 0.22
189 0.21
190 0.18
191 0.16
192 0.16
193 0.14
194 0.12
195 0.07
196 0.06
197 0.06
198 0.05
199 0.06
200 0.07
201 0.07
202 0.08
203 0.14
204 0.16
205 0.17
206 0.17
207 0.17
208 0.15
209 0.21
210 0.2
211 0.2
212 0.19
213 0.2
214 0.25
215 0.25
216 0.26
217 0.23
218 0.25
219 0.25
220 0.24
221 0.23
222 0.18
223 0.18
224 0.2
225 0.18
226 0.15
227 0.13
228 0.12
229 0.12
230 0.12
231 0.11
232 0.08
233 0.06
234 0.08
235 0.06
236 0.06
237 0.06
238 0.06
239 0.07
240 0.08
241 0.09
242 0.07
243 0.08
244 0.11
245 0.13
246 0.13
247 0.14
248 0.14
249 0.13
250 0.13
251 0.12
252 0.09
253 0.08
254 0.09
255 0.08
256 0.07
257 0.07
258 0.07
259 0.1
260 0.1
261 0.09
262 0.12
263 0.13
264 0.15
265 0.16
266 0.2
267 0.22
268 0.24
269 0.24
270 0.25
271 0.33
272 0.35
273 0.4
274 0.37
275 0.34
276 0.33
277 0.32
278 0.3
279 0.27
280 0.32
281 0.32
282 0.41
283 0.41
284 0.46
285 0.52
286 0.54
287 0.5
288 0.48
289 0.49
290 0.47
291 0.49
292 0.46
293 0.47
294 0.43
295 0.42
296 0.36
297 0.33
298 0.31
299 0.3
300 0.29
301 0.24
302 0.25
303 0.27
304 0.26
305 0.25
306 0.23
307 0.22
308 0.25
309 0.24
310 0.22
311 0.2
312 0.19
313 0.16
314 0.16
315 0.16
316 0.12
317 0.13
318 0.13
319 0.16
320 0.16
321 0.18
322 0.17
323 0.17
324 0.17
325 0.16
326 0.17
327 0.15
328 0.18
329 0.16
330 0.19
331 0.24
332 0.25
333 0.24
334 0.23
335 0.23
336 0.21
337 0.21
338 0.2
339 0.18
340 0.19
341 0.2
342 0.2
343 0.19
344 0.17
345 0.17
346 0.17
347 0.13
348 0.11
349 0.15
350 0.21
351 0.28
352 0.3
353 0.32
354 0.33
355 0.39
356 0.41
357 0.45
358 0.47
359 0.43
360 0.44
361 0.44
362 0.42
363 0.35
364 0.32
365 0.26
366 0.2
367 0.17
368 0.15
369 0.15
370 0.16
371 0.19
372 0.26
373 0.31
374 0.35
375 0.39
376 0.43
377 0.5
378 0.59
379 0.63
380 0.64
381 0.64
382 0.6
383 0.58
384 0.56
385 0.49
386 0.43
387 0.39
388 0.32
389 0.33
390 0.34
391 0.32
392 0.35
393 0.39
394 0.39
395 0.36
396 0.39
397 0.35
398 0.34
399 0.41
400 0.43
401 0.45
402 0.44