Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AQ91

Protein Details
Accession A0A437AQ91   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-53YMQILEKRNQPKERKPRSDLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000915  60S_ribosomal_L6E  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01159  Ribosomal_L6e  
Amino Acid Sequences MVDPKKNFITINNRKIRVLPECAGYYPADDMPEYMQILEKRNQPKERKPRSDLVTGMVVIVLEGEFAARRVVFLKQLPGNKALCCGPQPINKVPFFTIDERFLLKTSTILDISVNCDKIESKDVYDCMSEAEITENKTSEMKKVEDEILKAISKVKFMRTYLETLFNINENEGEVPTNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.6
4 0.55
5 0.51
6 0.43
7 0.39
8 0.38
9 0.38
10 0.37
11 0.31
12 0.26
13 0.2
14 0.19
15 0.15
16 0.13
17 0.12
18 0.12
19 0.14
20 0.13
21 0.11
22 0.14
23 0.16
24 0.2
25 0.24
26 0.3
27 0.36
28 0.44
29 0.53
30 0.57
31 0.66
32 0.73
33 0.79
34 0.81
35 0.79
36 0.78
37 0.75
38 0.73
39 0.63
40 0.55
41 0.46
42 0.37
43 0.31
44 0.22
45 0.16
46 0.1
47 0.09
48 0.05
49 0.03
50 0.02
51 0.03
52 0.03
53 0.03
54 0.04
55 0.04
56 0.04
57 0.06
58 0.07
59 0.1
60 0.11
61 0.16
62 0.19
63 0.23
64 0.25
65 0.27
66 0.27
67 0.24
68 0.25
69 0.21
70 0.18
71 0.15
72 0.17
73 0.18
74 0.21
75 0.26
76 0.29
77 0.33
78 0.32
79 0.32
80 0.3
81 0.28
82 0.26
83 0.25
84 0.22
85 0.19
86 0.19
87 0.19
88 0.19
89 0.17
90 0.14
91 0.11
92 0.1
93 0.1
94 0.11
95 0.09
96 0.09
97 0.09
98 0.09
99 0.14
100 0.16
101 0.15
102 0.13
103 0.13
104 0.13
105 0.15
106 0.2
107 0.16
108 0.16
109 0.18
110 0.19
111 0.2
112 0.2
113 0.18
114 0.14
115 0.13
116 0.11
117 0.08
118 0.11
119 0.11
120 0.13
121 0.14
122 0.13
123 0.14
124 0.17
125 0.17
126 0.18
127 0.21
128 0.21
129 0.22
130 0.25
131 0.3
132 0.3
133 0.31
134 0.29
135 0.28
136 0.27
137 0.25
138 0.27
139 0.23
140 0.24
141 0.26
142 0.3
143 0.32
144 0.33
145 0.39
146 0.37
147 0.41
148 0.39
149 0.44
150 0.37
151 0.33
152 0.34
153 0.3
154 0.27
155 0.23
156 0.2
157 0.14
158 0.15
159 0.13