Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AP16

Protein Details
Accession A0A437AP16   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-51NKMFYKLKLKNNLKEKKKKRYSDQFKDKSFDHydrophilic
NLS Segment(s)
PositionSequence
29-41LKNNLKEKKKKRY
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031509  Mei5-like  
Pfam View protein in Pfam  
PF17021  Mei5_like  
Amino Acid Sequences MYFTKINEEEKENYISIKVDNKMFYKLKLKNNLKEKKKKRYSDQFKDKSFDKKDILRKLKIIKSFKENNSDLEFLIEKWTKCIGECIFCLSREYFLPANQIFKAFSLKKHGFNYDDFCNNSEIEEENCFSENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.21
4 0.24
5 0.24
6 0.24
7 0.27
8 0.28
9 0.35
10 0.35
11 0.38
12 0.41
13 0.45
14 0.5
15 0.58
16 0.64
17 0.65
18 0.74
19 0.79
20 0.8
21 0.83
22 0.84
23 0.85
24 0.87
25 0.87
26 0.87
27 0.88
28 0.89
29 0.89
30 0.9
31 0.88
32 0.81
33 0.77
34 0.69
35 0.67
36 0.6
37 0.54
38 0.46
39 0.45
40 0.5
41 0.56
42 0.59
43 0.53
44 0.53
45 0.56
46 0.56
47 0.57
48 0.53
49 0.46
50 0.47
51 0.52
52 0.51
53 0.51
54 0.47
55 0.42
56 0.4
57 0.38
58 0.3
59 0.24
60 0.21
61 0.14
62 0.18
63 0.18
64 0.14
65 0.15
66 0.17
67 0.16
68 0.15
69 0.2
70 0.17
71 0.17
72 0.18
73 0.22
74 0.22
75 0.22
76 0.24
77 0.19
78 0.19
79 0.17
80 0.21
81 0.16
82 0.16
83 0.21
84 0.2
85 0.23
86 0.22
87 0.22
88 0.18
89 0.18
90 0.25
91 0.21
92 0.23
93 0.29
94 0.33
95 0.39
96 0.42
97 0.46
98 0.41
99 0.44
100 0.46
101 0.43
102 0.44
103 0.39
104 0.36
105 0.33
106 0.3
107 0.27
108 0.22
109 0.18
110 0.15
111 0.17
112 0.17
113 0.17