Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A437AIH9

Protein Details
Accession A0A437AIH9   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
194-217QKLYLAKRIKKVKIEKRSRFNLVMHydrophilic
NLS Segment(s)
PositionSequence
201-210RIKKVKIEKR
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences ITENNMIRTEQTQIKNENNIAVQSEPDKMSKAFKNDLNYIEKDQLSVLPCNTKHNLTNFQAVDFSPLPCLGEVAQKFENSFKNDLNILNFKERTKNKNKDQFNELRNKFNSFSSQKLKLQKKVKVKITPSESFLKLLNFFNKKDELSPETNKKEENLSNKKSSKPKKVSFLEYPVTEVFFIETRKLTGPELAYQKLYLAKRIKKVKIEKRSRFNLVMAEENSNKISRERLLKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.49
4 0.47
5 0.4
6 0.36
7 0.32
8 0.27
9 0.23
10 0.19
11 0.21
12 0.19
13 0.18
14 0.2
15 0.19
16 0.25
17 0.28
18 0.33
19 0.35
20 0.38
21 0.43
22 0.45
23 0.49
24 0.48
25 0.46
26 0.44
27 0.43
28 0.38
29 0.32
30 0.29
31 0.27
32 0.24
33 0.23
34 0.21
35 0.23
36 0.24
37 0.29
38 0.31
39 0.31
40 0.32
41 0.35
42 0.41
43 0.37
44 0.45
45 0.39
46 0.37
47 0.35
48 0.31
49 0.31
50 0.24
51 0.21
52 0.14
53 0.14
54 0.14
55 0.12
56 0.13
57 0.08
58 0.14
59 0.14
60 0.18
61 0.19
62 0.19
63 0.2
64 0.23
65 0.27
66 0.24
67 0.27
68 0.22
69 0.23
70 0.24
71 0.25
72 0.25
73 0.23
74 0.22
75 0.25
76 0.26
77 0.24
78 0.31
79 0.35
80 0.4
81 0.47
82 0.54
83 0.58
84 0.66
85 0.71
86 0.67
87 0.7
88 0.7
89 0.65
90 0.66
91 0.59
92 0.56
93 0.52
94 0.5
95 0.43
96 0.36
97 0.37
98 0.29
99 0.33
100 0.31
101 0.35
102 0.37
103 0.45
104 0.49
105 0.5
106 0.55
107 0.57
108 0.62
109 0.65
110 0.68
111 0.66
112 0.64
113 0.63
114 0.63
115 0.58
116 0.51
117 0.48
118 0.4
119 0.34
120 0.32
121 0.25
122 0.21
123 0.21
124 0.24
125 0.23
126 0.23
127 0.24
128 0.26
129 0.25
130 0.24
131 0.26
132 0.24
133 0.27
134 0.33
135 0.39
136 0.4
137 0.41
138 0.4
139 0.37
140 0.37
141 0.36
142 0.39
143 0.41
144 0.43
145 0.5
146 0.53
147 0.59
148 0.63
149 0.68
150 0.69
151 0.69
152 0.7
153 0.71
154 0.74
155 0.75
156 0.71
157 0.68
158 0.62
159 0.52
160 0.49
161 0.39
162 0.34
163 0.26
164 0.2
165 0.15
166 0.12
167 0.13
168 0.12
169 0.12
170 0.13
171 0.15
172 0.17
173 0.16
174 0.18
175 0.19
176 0.24
177 0.28
178 0.28
179 0.27
180 0.26
181 0.26
182 0.29
183 0.28
184 0.3
185 0.34
186 0.39
187 0.47
188 0.56
189 0.62
190 0.65
191 0.75
192 0.77
193 0.79
194 0.84
195 0.85
196 0.85
197 0.87
198 0.84
199 0.77
200 0.68
201 0.63
202 0.56
203 0.53
204 0.46
205 0.43
206 0.37
207 0.36
208 0.36
209 0.31
210 0.28
211 0.22
212 0.24
213 0.24
214 0.34