Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VZA5

Protein Details
Accession K1VZA5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-47TPKVEPQEKKKSPKGRAKKRAQYTRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
13-38KVKSQTPKVEPQEKKKSPKGRAKKRA
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKSPKGRAKKRAQYTRRFVNVTLTPGGKRSMNAQPAGKSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.46
4 0.47
5 0.49
6 0.58
7 0.6
8 0.65
9 0.65
10 0.67
11 0.71
12 0.72
13 0.75
14 0.74
15 0.76
16 0.75
17 0.79
18 0.8
19 0.8
20 0.84
21 0.86
22 0.87
23 0.88
24 0.89
25 0.87
26 0.86
27 0.82
28 0.81
29 0.76
30 0.69
31 0.59
32 0.56
33 0.5
34 0.44
35 0.4
36 0.32
37 0.27
38 0.26
39 0.28
40 0.22
41 0.19
42 0.21
43 0.27
44 0.31
45 0.35
46 0.38