Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VF65

Protein Details
Accession K1VF65   
Localization Confidence High
Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
71-94LAQAGSEKKQPKRKRPTTASEFGSHydrophilic
101-124AEPTSKKAKKVKKEDDKKPKSQPIBasic
NLS Segment(s)
PositionSequence
24-29GSKGKA
78-85KKQPKRKR
106-123KKAKKVKKEDDKKPKSQP
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MSSKTAPKSILKKPAVAGPSKLTGSKGKAKATVAVKTAKVKAPSPEPESSDDNDFPDDDEYELDTEDEIELAQAGSEKKQPKRKRPTTASEFGSTLTSLLAEPTSKKAKKVKKEDDKKPKSQPILALSAKPLPPSQAAERLERRAARVLKAERMERLDRARVRDVVEGWVPAPGAEMGSQEFERALRKTAQRGVIKLFNAILVASKNAEAAAKTLSDKAGLKPEAPKSRKEKDNILGRGGKDDVLTKESFLDLVRRGSAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.49
4 0.44
5 0.38
6 0.39
7 0.37
8 0.36
9 0.32
10 0.33
11 0.36
12 0.42
13 0.43
14 0.43
15 0.45
16 0.46
17 0.5
18 0.49
19 0.49
20 0.43
21 0.42
22 0.41
23 0.42
24 0.45
25 0.43
26 0.41
27 0.39
28 0.4
29 0.43
30 0.47
31 0.48
32 0.47
33 0.45
34 0.46
35 0.47
36 0.44
37 0.41
38 0.35
39 0.3
40 0.27
41 0.24
42 0.2
43 0.18
44 0.16
45 0.11
46 0.11
47 0.1
48 0.1
49 0.1
50 0.09
51 0.07
52 0.07
53 0.06
54 0.06
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.06
62 0.08
63 0.14
64 0.21
65 0.28
66 0.38
67 0.48
68 0.57
69 0.68
70 0.76
71 0.81
72 0.82
73 0.85
74 0.84
75 0.82
76 0.75
77 0.66
78 0.56
79 0.46
80 0.38
81 0.28
82 0.2
83 0.12
84 0.08
85 0.06
86 0.06
87 0.05
88 0.05
89 0.06
90 0.11
91 0.2
92 0.2
93 0.25
94 0.33
95 0.41
96 0.5
97 0.61
98 0.67
99 0.69
100 0.79
101 0.85
102 0.88
103 0.88
104 0.86
105 0.83
106 0.79
107 0.71
108 0.64
109 0.58
110 0.5
111 0.49
112 0.42
113 0.34
114 0.28
115 0.28
116 0.26
117 0.22
118 0.18
119 0.13
120 0.13
121 0.15
122 0.16
123 0.2
124 0.22
125 0.26
126 0.29
127 0.3
128 0.32
129 0.3
130 0.3
131 0.29
132 0.29
133 0.26
134 0.31
135 0.31
136 0.33
137 0.36
138 0.35
139 0.31
140 0.34
141 0.34
142 0.3
143 0.31
144 0.33
145 0.33
146 0.36
147 0.37
148 0.34
149 0.35
150 0.34
151 0.31
152 0.27
153 0.25
154 0.2
155 0.16
156 0.15
157 0.12
158 0.09
159 0.09
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.08
166 0.09
167 0.08
168 0.08
169 0.08
170 0.12
171 0.12
172 0.14
173 0.18
174 0.21
175 0.27
176 0.33
177 0.41
178 0.41
179 0.42
180 0.45
181 0.44
182 0.42
183 0.37
184 0.31
185 0.23
186 0.2
187 0.17
188 0.13
189 0.09
190 0.09
191 0.09
192 0.09
193 0.08
194 0.08
195 0.09
196 0.08
197 0.08
198 0.09
199 0.09
200 0.1
201 0.12
202 0.12
203 0.14
204 0.16
205 0.17
206 0.25
207 0.25
208 0.26
209 0.31
210 0.4
211 0.48
212 0.49
213 0.54
214 0.54
215 0.62
216 0.68
217 0.66
218 0.66
219 0.64
220 0.72
221 0.68
222 0.67
223 0.63
224 0.56
225 0.55
226 0.47
227 0.39
228 0.3
229 0.3
230 0.26
231 0.25
232 0.25
233 0.21
234 0.21
235 0.21
236 0.2
237 0.17
238 0.19
239 0.17
240 0.2