Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VEH4

Protein Details
Accession K1VEH4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-44LAVRLYQVLPRRNRPRRKDSDKRPTRSLAHydrophilic
NLS Segment(s)
PositionSequence
26-38RRNRPRRKDSDKR
Subcellular Location(s) extr 13, plas 10, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013969  Oligosacch_biosynth_Alg14  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0031965  C:nuclear membrane  
GO:0006488  P:dolichol-linked oligosaccharide biosynthetic process  
Pfam View protein in Pfam  
PF08660  Alg14  
Amino Acid Sequences MLAQLILAAAALGLLLAVRLYQVLPRRNRPRRKDSDKRPTRSLAVFLGSGGHTAEMRTMLRALDRRKYTPRIYVYGAGDALSLRAVSELEEDAKSSEYSLLALPRARAVGEGKLSTLVSASRTLAVTLRHTFFLPLIQRPSEPWADVLVLNGPGTAAVLVLVAQVFGLRYTKIVYVESFARVKSLSLTGKLLRPLVDTFVVQWPDAAGDGAAPGSGTTYKGWLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.03
6 0.03
7 0.04
8 0.09
9 0.16
10 0.25
11 0.33
12 0.43
13 0.55
14 0.65
15 0.75
16 0.8
17 0.84
18 0.87
19 0.9
20 0.91
21 0.91
22 0.92
23 0.92
24 0.89
25 0.84
26 0.78
27 0.73
28 0.64
29 0.56
30 0.48
31 0.4
32 0.32
33 0.26
34 0.23
35 0.17
36 0.15
37 0.12
38 0.09
39 0.07
40 0.07
41 0.08
42 0.08
43 0.08
44 0.09
45 0.09
46 0.09
47 0.13
48 0.19
49 0.22
50 0.29
51 0.32
52 0.37
53 0.43
54 0.49
55 0.49
56 0.51
57 0.52
58 0.47
59 0.47
60 0.47
61 0.41
62 0.36
63 0.32
64 0.24
65 0.2
66 0.15
67 0.12
68 0.07
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.07
77 0.07
78 0.07
79 0.08
80 0.09
81 0.08
82 0.08
83 0.08
84 0.06
85 0.07
86 0.07
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.08
94 0.08
95 0.09
96 0.1
97 0.11
98 0.11
99 0.1
100 0.11
101 0.11
102 0.09
103 0.08
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.08
110 0.08
111 0.09
112 0.1
113 0.13
114 0.15
115 0.16
116 0.15
117 0.15
118 0.15
119 0.14
120 0.18
121 0.17
122 0.17
123 0.19
124 0.19
125 0.19
126 0.2
127 0.23
128 0.2
129 0.18
130 0.15
131 0.14
132 0.14
133 0.14
134 0.13
135 0.1
136 0.09
137 0.09
138 0.08
139 0.06
140 0.05
141 0.05
142 0.05
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.04
154 0.05
155 0.05
156 0.06
157 0.08
158 0.1
159 0.11
160 0.12
161 0.12
162 0.14
163 0.16
164 0.2
165 0.19
166 0.17
167 0.17
168 0.16
169 0.16
170 0.15
171 0.19
172 0.18
173 0.19
174 0.24
175 0.25
176 0.29
177 0.31
178 0.31
179 0.25
180 0.25
181 0.24
182 0.24
183 0.23
184 0.19
185 0.19
186 0.24
187 0.25
188 0.22
189 0.21
190 0.17
191 0.16
192 0.16
193 0.14
194 0.07
195 0.06
196 0.06
197 0.06
198 0.05
199 0.05
200 0.04
201 0.06
202 0.07
203 0.08
204 0.09