Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VD04

Protein Details
Accession K1VD04    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
9-30IPLRAAWRVHQRHRHDMRQNDEHydrophilic
47-78ENRQITKLWARRARNRQRARPHRSCRHHASGIHydrophilic
NLS Segment(s)
PositionSequence
57-67RRARNRQRARP
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019711  ATP_synth_F0_suH  
Gene Ontology GO:0000276  C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF10775  ATP_sub_h  
Amino Acid Sequences MLFRLTVGIPLRAAWRVHQRHRHDMRQNDECTESEIGPRGFSTPRNENRQITKLWARRARNRQRARPHRSCRHHASGIVRDAVMMLELQEMVLQAGTAESGIGLCGVPRIYGDHALAPTAHRSARRQAACSSPARSRSTPQGSGQITNFTQAQRTPALARQFSASAQRGDLVKDMYLNQLKNYKAPATSKADAEQHVRKFTAPEPPKAPELPSDLAADMSAFDAQNPTIGGPKKAVKAEKTESDGMTADQYLKFLEQPLPKEEKHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.33
3 0.4
4 0.5
5 0.58
6 0.63
7 0.71
8 0.78
9 0.83
10 0.81
11 0.81
12 0.8
13 0.79
14 0.74
15 0.66
16 0.6
17 0.5
18 0.45
19 0.38
20 0.3
21 0.23
22 0.26
23 0.23
24 0.21
25 0.21
26 0.2
27 0.19
28 0.23
29 0.28
30 0.32
31 0.4
32 0.48
33 0.54
34 0.57
35 0.61
36 0.62
37 0.56
38 0.54
39 0.56
40 0.53
41 0.57
42 0.6
43 0.6
44 0.66
45 0.75
46 0.79
47 0.8
48 0.84
49 0.84
50 0.87
51 0.91
52 0.91
53 0.91
54 0.9
55 0.9
56 0.88
57 0.87
58 0.84
59 0.82
60 0.75
61 0.68
62 0.65
63 0.61
64 0.55
65 0.48
66 0.39
67 0.3
68 0.27
69 0.22
70 0.15
71 0.08
72 0.05
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.02
86 0.02
87 0.02
88 0.02
89 0.03
90 0.03
91 0.02
92 0.03
93 0.04
94 0.04
95 0.04
96 0.06
97 0.07
98 0.09
99 0.1
100 0.11
101 0.11
102 0.11
103 0.11
104 0.1
105 0.1
106 0.1
107 0.11
108 0.11
109 0.13
110 0.19
111 0.27
112 0.28
113 0.29
114 0.3
115 0.33
116 0.35
117 0.35
118 0.33
119 0.28
120 0.32
121 0.34
122 0.33
123 0.3
124 0.35
125 0.37
126 0.37
127 0.35
128 0.37
129 0.34
130 0.35
131 0.33
132 0.28
133 0.22
134 0.21
135 0.2
136 0.13
137 0.13
138 0.12
139 0.14
140 0.11
141 0.13
142 0.13
143 0.17
144 0.22
145 0.21
146 0.21
147 0.2
148 0.2
149 0.19
150 0.24
151 0.21
152 0.17
153 0.17
154 0.18
155 0.17
156 0.17
157 0.18
158 0.12
159 0.1
160 0.11
161 0.11
162 0.15
163 0.19
164 0.18
165 0.19
166 0.23
167 0.24
168 0.25
169 0.27
170 0.23
171 0.23
172 0.25
173 0.29
174 0.32
175 0.33
176 0.33
177 0.33
178 0.34
179 0.33
180 0.36
181 0.37
182 0.33
183 0.34
184 0.33
185 0.31
186 0.31
187 0.31
188 0.36
189 0.33
190 0.35
191 0.37
192 0.39
193 0.42
194 0.41
195 0.4
196 0.32
197 0.34
198 0.3
199 0.27
200 0.26
201 0.22
202 0.21
203 0.19
204 0.16
205 0.1
206 0.09
207 0.08
208 0.07
209 0.07
210 0.08
211 0.08
212 0.09
213 0.09
214 0.09
215 0.14
216 0.16
217 0.17
218 0.21
219 0.26
220 0.3
221 0.36
222 0.42
223 0.39
224 0.45
225 0.51
226 0.53
227 0.54
228 0.52
229 0.47
230 0.43
231 0.4
232 0.32
233 0.28
234 0.22
235 0.18
236 0.15
237 0.15
238 0.13
239 0.14
240 0.14
241 0.14
242 0.21
243 0.24
244 0.28
245 0.35
246 0.4