Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427YLT0

Protein Details
Accession A0A427YLT0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-56AQSETVPMREKWRKKRMRKLRRRRRKLRARSNLLLLLHydrophilic
NLS Segment(s)
PositionSequence
28-49REKWRKKRMRKLRRRRRKLRAR
Subcellular Location(s) cyto 12, nucl 7, pero 3, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008576  MeTrfase_NTM1  
IPR007836  Ribosomal_L41  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008276  F:protein methyltransferase activity  
GO:0003735  F:structural constituent of ribosome  
GO:0006480  P:N-terminal protein amino acid methylation  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05891  Methyltransf_PK  
PF05162  Ribosomal_L41  
Amino Acid Sequences MSFHESCVLGVGFGQPLLEAQSETVPMREKWRKKRMRKLRRRRRKLRARSNLLLLLTPKDSAAKRQKSNLGSALRKPPGPDYEKGVRYWDNIDATVNGVLGGFGNGPVPHVEQLSSRLLLLSLLPQLHTFPSPLTPLPPPPAPHRRTALDVGAGIGRVTRHVLLPLFDDVVLLEPVAKFVSEAHRAAAAGEWRDLPRAGKQPETEEGTEQWKEGQRRVEESQAGRGKRVWFVRGGLQGFDPRLPVKAGDDLGVVGDAKVGEGSELGDADASVVYDTIWCQWCLGHMTHADLVTFLRRSRAALRGSSGDASMSDASDGGYDSLIFVKENVCEDGPDGKAVEFLDEEDSSLTRSNGKWLEVFNEAGLEVVKEEVQEGMLDELFMVKTWALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.07
4 0.1
5 0.1
6 0.08
7 0.09
8 0.11
9 0.13
10 0.14
11 0.16
12 0.18
13 0.18
14 0.28
15 0.38
16 0.46
17 0.54
18 0.65
19 0.74
20 0.81
21 0.91
22 0.92
23 0.93
24 0.95
25 0.95
26 0.96
27 0.97
28 0.97
29 0.97
30 0.97
31 0.97
32 0.96
33 0.96
34 0.96
35 0.94
36 0.89
37 0.85
38 0.78
39 0.68
40 0.59
41 0.49
42 0.41
43 0.33
44 0.26
45 0.2
46 0.2
47 0.2
48 0.27
49 0.36
50 0.42
51 0.46
52 0.53
53 0.61
54 0.59
55 0.64
56 0.62
57 0.6
58 0.56
59 0.57
60 0.59
61 0.54
62 0.53
63 0.48
64 0.46
65 0.46
66 0.46
67 0.42
68 0.4
69 0.46
70 0.47
71 0.46
72 0.45
73 0.38
74 0.35
75 0.36
76 0.33
77 0.26
78 0.24
79 0.24
80 0.19
81 0.19
82 0.17
83 0.14
84 0.1
85 0.07
86 0.07
87 0.06
88 0.06
89 0.05
90 0.04
91 0.06
92 0.06
93 0.07
94 0.08
95 0.09
96 0.09
97 0.1
98 0.1
99 0.1
100 0.14
101 0.16
102 0.15
103 0.14
104 0.13
105 0.12
106 0.12
107 0.11
108 0.09
109 0.09
110 0.09
111 0.1
112 0.1
113 0.11
114 0.11
115 0.12
116 0.1
117 0.09
118 0.1
119 0.12
120 0.12
121 0.14
122 0.15
123 0.17
124 0.21
125 0.23
126 0.24
127 0.3
128 0.39
129 0.39
130 0.42
131 0.44
132 0.42
133 0.43
134 0.43
135 0.37
136 0.28
137 0.25
138 0.21
139 0.17
140 0.15
141 0.11
142 0.08
143 0.07
144 0.06
145 0.07
146 0.07
147 0.07
148 0.08
149 0.09
150 0.09
151 0.11
152 0.11
153 0.1
154 0.1
155 0.09
156 0.07
157 0.08
158 0.08
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.04
166 0.05
167 0.1
168 0.13
169 0.13
170 0.13
171 0.14
172 0.14
173 0.14
174 0.15
175 0.11
176 0.09
177 0.09
178 0.1
179 0.1
180 0.11
181 0.11
182 0.1
183 0.13
184 0.2
185 0.21
186 0.23
187 0.24
188 0.26
189 0.29
190 0.32
191 0.28
192 0.22
193 0.21
194 0.22
195 0.21
196 0.18
197 0.18
198 0.18
199 0.19
200 0.21
201 0.26
202 0.24
203 0.29
204 0.31
205 0.33
206 0.32
207 0.32
208 0.37
209 0.37
210 0.35
211 0.31
212 0.32
213 0.29
214 0.31
215 0.32
216 0.25
217 0.21
218 0.23
219 0.27
220 0.29
221 0.28
222 0.23
223 0.22
224 0.22
225 0.21
226 0.2
227 0.16
228 0.11
229 0.12
230 0.12
231 0.11
232 0.11
233 0.13
234 0.13
235 0.12
236 0.12
237 0.11
238 0.1
239 0.1
240 0.08
241 0.05
242 0.05
243 0.04
244 0.04
245 0.04
246 0.04
247 0.03
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.03
260 0.04
261 0.04
262 0.04
263 0.08
264 0.1
265 0.1
266 0.1
267 0.1
268 0.12
269 0.16
270 0.16
271 0.16
272 0.15
273 0.17
274 0.19
275 0.19
276 0.17
277 0.14
278 0.14
279 0.15
280 0.15
281 0.13
282 0.14
283 0.14
284 0.17
285 0.22
286 0.28
287 0.28
288 0.29
289 0.32
290 0.32
291 0.33
292 0.31
293 0.27
294 0.2
295 0.16
296 0.17
297 0.14
298 0.11
299 0.09
300 0.08
301 0.08
302 0.08
303 0.08
304 0.06
305 0.05
306 0.05
307 0.06
308 0.07
309 0.07
310 0.07
311 0.07
312 0.09
313 0.1
314 0.13
315 0.15
316 0.14
317 0.14
318 0.16
319 0.2
320 0.19
321 0.19
322 0.17
323 0.15
324 0.16
325 0.16
326 0.15
327 0.11
328 0.11
329 0.14
330 0.13
331 0.13
332 0.13
333 0.13
334 0.13
335 0.14
336 0.13
337 0.13
338 0.14
339 0.21
340 0.23
341 0.25
342 0.26
343 0.26
344 0.3
345 0.29
346 0.3
347 0.22
348 0.2
349 0.17
350 0.15
351 0.14
352 0.1
353 0.08
354 0.08
355 0.08
356 0.07
357 0.07
358 0.07
359 0.08
360 0.08
361 0.08
362 0.09
363 0.09
364 0.09
365 0.08
366 0.1
367 0.09
368 0.09
369 0.09