Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427Y261

Protein Details
Accession A0A427Y261   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-123PLDLRYKKTRAIRRRLTHKEASAKTEKQRKKDIHFPARKFBasic
NLS Segment(s)
PositionSequence
90-126KKTRAIRRRLTHKEASAKTEKQRKKDIHFPARKFALK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSSSSKIRAFELQSKNKQDLLTQLSELKTELASLRVAKITGGSSSKVNKINSVRKSIARVLTVINQKQRENLRSYYKGKNYLPLDLRYKKTRAIRRRLTHKEASAKTEKQRKKDIHFPARKFALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.64
4 0.61
5 0.56
6 0.47
7 0.44
8 0.4
9 0.34
10 0.3
11 0.31
12 0.28
13 0.28
14 0.27
15 0.2
16 0.14
17 0.12
18 0.11
19 0.09
20 0.1
21 0.1
22 0.12
23 0.12
24 0.12
25 0.11
26 0.11
27 0.11
28 0.11
29 0.12
30 0.12
31 0.14
32 0.16
33 0.21
34 0.25
35 0.25
36 0.28
37 0.34
38 0.41
39 0.42
40 0.46
41 0.44
42 0.4
43 0.44
44 0.42
45 0.38
46 0.3
47 0.27
48 0.22
49 0.26
50 0.29
51 0.28
52 0.29
53 0.28
54 0.28
55 0.32
56 0.35
57 0.33
58 0.32
59 0.34
60 0.37
61 0.41
62 0.46
63 0.49
64 0.49
65 0.53
66 0.49
67 0.52
68 0.46
69 0.46
70 0.45
71 0.42
72 0.46
73 0.45
74 0.49
75 0.46
76 0.46
77 0.46
78 0.51
79 0.56
80 0.58
81 0.63
82 0.69
83 0.73
84 0.82
85 0.85
86 0.84
87 0.81
88 0.79
89 0.78
90 0.71
91 0.69
92 0.66
93 0.62
94 0.64
95 0.66
96 0.65
97 0.62
98 0.69
99 0.7
100 0.7
101 0.74
102 0.76
103 0.77
104 0.82
105 0.79
106 0.78
107 0.78