Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427YPS5

Protein Details
Accession A0A427YPS5   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
123-154RSHLRMRSERPPRRHLRCRYLRHQARRYIKAYBasic
NLS Segment(s)
PositionSequence
118-138RRAPGRSHLRMRSERPPRRHL
Subcellular Location(s) mito 14, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSRLLSSLFGSKKNADTIPSSSSPSLPDTQPSSTGSSAFQNFMANQWDTALGSAPGSSGDIGAPYMSGAIQVDAAGTGDGGRGDIKSHLGFGSGASQPSVVYPYSSVYSAPPSSFPHRRAPGRSHLRMRSERPPRRHLRCRYLRHQARRYIKAYHTPRLRHAVHNSFHNPSTTPSTTPTTSTTPTTPTSASTSASPLSASYTERVPAGTDEEPRSARLRLDDHGRVTDIFFEAIEGTASVNFKRDNGETSVVTYSFHGVGADKVARGTLTVQDLAPGQLASSSTPTAPPSTATPSVLGPDNSEMSWALGWAGGDQELAAEHLDRLAGTYDAVRSIWDTTRHVEHPRKTALTPLEAYVSSLQLLNDTFATSIQQQDPSLSSQPLPTVEDLVDDLSRTLDGEGIRTTTEIPGHHMYRLHRELPDLVSRLAGPIGTPQWKDNRTRDIDSLHWAYGVGRGAEDKVFETDTATARWRDYMSTRRVIDEYADAHPAVRTEMTDEDKHTLAMRTVDDQASVTEQLDRFRRSLSSRNQSAFYPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.34
4 0.35
5 0.37
6 0.36
7 0.37
8 0.33
9 0.32
10 0.32
11 0.32
12 0.32
13 0.27
14 0.29
15 0.29
16 0.3
17 0.32
18 0.32
19 0.32
20 0.29
21 0.29
22 0.25
23 0.27
24 0.27
25 0.25
26 0.24
27 0.22
28 0.21
29 0.23
30 0.26
31 0.21
32 0.19
33 0.18
34 0.18
35 0.16
36 0.16
37 0.15
38 0.1
39 0.09
40 0.09
41 0.08
42 0.07
43 0.08
44 0.08
45 0.07
46 0.06
47 0.07
48 0.07
49 0.07
50 0.06
51 0.05
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.05
59 0.06
60 0.05
61 0.06
62 0.05
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.08
72 0.12
73 0.11
74 0.13
75 0.12
76 0.13
77 0.13
78 0.12
79 0.16
80 0.15
81 0.15
82 0.14
83 0.14
84 0.13
85 0.13
86 0.15
87 0.1
88 0.09
89 0.09
90 0.11
91 0.12
92 0.13
93 0.12
94 0.12
95 0.16
96 0.17
97 0.17
98 0.18
99 0.22
100 0.29
101 0.36
102 0.38
103 0.43
104 0.5
105 0.55
106 0.59
107 0.61
108 0.64
109 0.67
110 0.71
111 0.71
112 0.7
113 0.72
114 0.73
115 0.72
116 0.72
117 0.73
118 0.73
119 0.72
120 0.75
121 0.77
122 0.8
123 0.84
124 0.84
125 0.84
126 0.85
127 0.87
128 0.85
129 0.86
130 0.86
131 0.86
132 0.85
133 0.83
134 0.82
135 0.8
136 0.75
137 0.7
138 0.65
139 0.64
140 0.62
141 0.62
142 0.6
143 0.56
144 0.58
145 0.59
146 0.58
147 0.55
148 0.57
149 0.56
150 0.51
151 0.55
152 0.54
153 0.49
154 0.46
155 0.41
156 0.33
157 0.28
158 0.32
159 0.26
160 0.24
161 0.24
162 0.27
163 0.26
164 0.27
165 0.28
166 0.24
167 0.24
168 0.25
169 0.23
170 0.22
171 0.23
172 0.23
173 0.2
174 0.19
175 0.21
176 0.19
177 0.19
178 0.16
179 0.17
180 0.15
181 0.15
182 0.13
183 0.09
184 0.1
185 0.1
186 0.11
187 0.1
188 0.1
189 0.11
190 0.11
191 0.11
192 0.1
193 0.09
194 0.12
195 0.13
196 0.16
197 0.17
198 0.2
199 0.2
200 0.21
201 0.23
202 0.2
203 0.18
204 0.18
205 0.18
206 0.18
207 0.25
208 0.26
209 0.26
210 0.26
211 0.26
212 0.23
213 0.21
214 0.19
215 0.13
216 0.09
217 0.08
218 0.07
219 0.06
220 0.06
221 0.05
222 0.04
223 0.04
224 0.05
225 0.06
226 0.06
227 0.07
228 0.07
229 0.08
230 0.1
231 0.11
232 0.12
233 0.15
234 0.18
235 0.16
236 0.18
237 0.18
238 0.16
239 0.16
240 0.13
241 0.11
242 0.09
243 0.09
244 0.07
245 0.06
246 0.06
247 0.08
248 0.08
249 0.07
250 0.06
251 0.07
252 0.06
253 0.06
254 0.07
255 0.07
256 0.08
257 0.08
258 0.08
259 0.09
260 0.09
261 0.09
262 0.09
263 0.06
264 0.05
265 0.05
266 0.05
267 0.05
268 0.06
269 0.06
270 0.06
271 0.07
272 0.08
273 0.09
274 0.09
275 0.09
276 0.1
277 0.14
278 0.15
279 0.15
280 0.15
281 0.14
282 0.16
283 0.16
284 0.14
285 0.1
286 0.11
287 0.11
288 0.1
289 0.1
290 0.09
291 0.08
292 0.07
293 0.06
294 0.05
295 0.05
296 0.05
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.04
303 0.03
304 0.04
305 0.04
306 0.04
307 0.04
308 0.04
309 0.04
310 0.04
311 0.05
312 0.05
313 0.05
314 0.05
315 0.06
316 0.06
317 0.07
318 0.07
319 0.06
320 0.06
321 0.09
322 0.12
323 0.13
324 0.15
325 0.17
326 0.21
327 0.24
328 0.31
329 0.36
330 0.38
331 0.42
332 0.45
333 0.45
334 0.41
335 0.44
336 0.39
337 0.35
338 0.31
339 0.26
340 0.23
341 0.2
342 0.22
343 0.16
344 0.14
345 0.11
346 0.1
347 0.09
348 0.08
349 0.08
350 0.08
351 0.07
352 0.07
353 0.07
354 0.06
355 0.08
356 0.08
357 0.11
358 0.12
359 0.13
360 0.13
361 0.14
362 0.16
363 0.18
364 0.19
365 0.17
366 0.16
367 0.15
368 0.17
369 0.17
370 0.17
371 0.14
372 0.13
373 0.12
374 0.12
375 0.12
376 0.12
377 0.1
378 0.09
379 0.08
380 0.07
381 0.07
382 0.07
383 0.06
384 0.07
385 0.07
386 0.09
387 0.1
388 0.1
389 0.1
390 0.1
391 0.11
392 0.1
393 0.13
394 0.12
395 0.16
396 0.21
397 0.22
398 0.24
399 0.27
400 0.28
401 0.35
402 0.4
403 0.37
404 0.33
405 0.34
406 0.34
407 0.35
408 0.38
409 0.31
410 0.27
411 0.24
412 0.23
413 0.22
414 0.19
415 0.15
416 0.09
417 0.1
418 0.15
419 0.19
420 0.2
421 0.23
422 0.31
423 0.36
424 0.43
425 0.45
426 0.5
427 0.52
428 0.55
429 0.55
430 0.51
431 0.49
432 0.49
433 0.45
434 0.36
435 0.3
436 0.25
437 0.22
438 0.22
439 0.21
440 0.15
441 0.12
442 0.12
443 0.14
444 0.14
445 0.15
446 0.13
447 0.12
448 0.13
449 0.13
450 0.14
451 0.15
452 0.17
453 0.18
454 0.2
455 0.2
456 0.2
457 0.22
458 0.21
459 0.22
460 0.27
461 0.34
462 0.37
463 0.44
464 0.44
465 0.45
466 0.45
467 0.42
468 0.38
469 0.33
470 0.29
471 0.24
472 0.25
473 0.21
474 0.21
475 0.21
476 0.19
477 0.16
478 0.14
479 0.12
480 0.12
481 0.18
482 0.22
483 0.24
484 0.27
485 0.28
486 0.28
487 0.28
488 0.27
489 0.24
490 0.22
491 0.22
492 0.22
493 0.22
494 0.25
495 0.25
496 0.23
497 0.22
498 0.2
499 0.2
500 0.19
501 0.16
502 0.18
503 0.19
504 0.24
505 0.3
506 0.32
507 0.3
508 0.31
509 0.36
510 0.37
511 0.45
512 0.5
513 0.54
514 0.59
515 0.62
516 0.61