Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427YQW9

Protein Details
Accession A0A427YQW9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-41AQAGSKAGKKKKWSKGKVKDKANNAVVHydrophilic
NLS Segment(s)
PositionSequence
11-35KAAAAQAGSKAGKKKKWSKGKVKDK
Subcellular Location(s) nucl 13, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPQVKSKAQKAAAAQAGSKAGKKKKWSKGKVKDKANNAVVLDKPTYDRIIKEVPTYRVISQSTLIDRMKINGSLARRAIAFLEKEGLIKRVVHHNAQLVYTRATAAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.41
3 0.33
4 0.34
5 0.31
6 0.31
7 0.3
8 0.32
9 0.36
10 0.46
11 0.54
12 0.6
13 0.7
14 0.77
15 0.81
16 0.85
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.82
23 0.73
24 0.65
25 0.54
26 0.48
27 0.38
28 0.33
29 0.27
30 0.18
31 0.16
32 0.15
33 0.16
34 0.14
35 0.13
36 0.14
37 0.17
38 0.17
39 0.2
40 0.23
41 0.23
42 0.25
43 0.27
44 0.24
45 0.25
46 0.24
47 0.21
48 0.18
49 0.18
50 0.16
51 0.19
52 0.18
53 0.16
54 0.16
55 0.17
56 0.17
57 0.16
58 0.16
59 0.14
60 0.17
61 0.19
62 0.2
63 0.19
64 0.17
65 0.17
66 0.17
67 0.18
68 0.17
69 0.13
70 0.15
71 0.14
72 0.16
73 0.17
74 0.17
75 0.15
76 0.15
77 0.17
78 0.24
79 0.28
80 0.29
81 0.32
82 0.36
83 0.36
84 0.37
85 0.38
86 0.31
87 0.29
88 0.26
89 0.24