Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427YQ71

Protein Details
Accession A0A427YQ71    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-121PDDTRGVARRRKRRRDVISWDMVRBasic
NLS Segment(s)
PositionSequence
105-112ARRRKRRR
Subcellular Location(s) plas 20, mito 2, nucl 1, extr 1, pero 1, E.R. 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007290  Arv1  
Gene Ontology GO:0032541  C:cortical endoplasmic reticulum  
GO:0005789  C:endoplasmic reticulum membrane  
GO:0000139  C:Golgi membrane  
GO:0032366  P:intracellular sterol transport  
GO:0097036  P:regulation of plasma membrane sterol distribution  
GO:0006665  P:sphingolipid metabolic process  
GO:0016125  P:sterol metabolic process  
Pfam View protein in Pfam  
PF04161  Arv1  
Amino Acid Sequences MPVCVSCAYPAEHLYTTYRTKSNIRLGVCARCDAFLDPLIEHPGLLILLDLILLKPRVYLHLMFNRGHEPLSADQAGTQSVKDSSNPKARDKATTPFPDDTRGVARRRKRRRDVISWDMVRLGLVTILAETAVRWMSSINPQPGAGWGSPELVAQHAVTLILGLAVLWWRGWYPARNKAKSSERDGRQENFLPALIPLTVLYTSLLPLILQLVLSIWYTPQSSIHESVPSLTSSIPADGTVPLPFPDFLARFLLDRLPPTWADTLREVHADMSRAWVSADRVWAGTRLLGGMAAGFGLRVILPTRPWETMGIVLAGWAAGAGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.3
4 0.33
5 0.34
6 0.33
7 0.37
8 0.44
9 0.5
10 0.51
11 0.48
12 0.5
13 0.52
14 0.57
15 0.54
16 0.49
17 0.4
18 0.34
19 0.34
20 0.28
21 0.26
22 0.21
23 0.21
24 0.18
25 0.19
26 0.22
27 0.2
28 0.18
29 0.15
30 0.12
31 0.11
32 0.1
33 0.08
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.07
40 0.07
41 0.07
42 0.09
43 0.09
44 0.12
45 0.16
46 0.18
47 0.23
48 0.31
49 0.35
50 0.35
51 0.37
52 0.36
53 0.33
54 0.31
55 0.24
56 0.2
57 0.17
58 0.22
59 0.2
60 0.17
61 0.17
62 0.17
63 0.18
64 0.15
65 0.13
66 0.09
67 0.11
68 0.11
69 0.13
70 0.16
71 0.22
72 0.31
73 0.35
74 0.38
75 0.44
76 0.45
77 0.49
78 0.49
79 0.48
80 0.48
81 0.51
82 0.51
83 0.47
84 0.47
85 0.44
86 0.41
87 0.36
88 0.34
89 0.34
90 0.34
91 0.38
92 0.46
93 0.52
94 0.62
95 0.71
96 0.74
97 0.79
98 0.82
99 0.85
100 0.85
101 0.83
102 0.82
103 0.72
104 0.63
105 0.53
106 0.43
107 0.33
108 0.24
109 0.15
110 0.06
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.06
124 0.12
125 0.18
126 0.18
127 0.19
128 0.19
129 0.19
130 0.2
131 0.21
132 0.15
133 0.11
134 0.1
135 0.1
136 0.1
137 0.1
138 0.09
139 0.07
140 0.07
141 0.06
142 0.06
143 0.05
144 0.04
145 0.04
146 0.04
147 0.03
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.03
154 0.02
155 0.03
156 0.03
157 0.05
158 0.06
159 0.11
160 0.16
161 0.26
162 0.36
163 0.38
164 0.39
165 0.45
166 0.52
167 0.53
168 0.56
169 0.55
170 0.51
171 0.55
172 0.58
173 0.53
174 0.49
175 0.46
176 0.39
177 0.3
178 0.26
179 0.19
180 0.15
181 0.14
182 0.09
183 0.07
184 0.06
185 0.06
186 0.06
187 0.06
188 0.06
189 0.05
190 0.06
191 0.06
192 0.06
193 0.04
194 0.04
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.05
203 0.04
204 0.06
205 0.07
206 0.07
207 0.09
208 0.11
209 0.15
210 0.17
211 0.19
212 0.19
213 0.18
214 0.19
215 0.19
216 0.16
217 0.13
218 0.1
219 0.1
220 0.1
221 0.1
222 0.09
223 0.08
224 0.08
225 0.08
226 0.09
227 0.09
228 0.09
229 0.09
230 0.1
231 0.1
232 0.1
233 0.14
234 0.14
235 0.15
236 0.17
237 0.17
238 0.17
239 0.18
240 0.21
241 0.18
242 0.19
243 0.18
244 0.18
245 0.18
246 0.2
247 0.24
248 0.21
249 0.23
250 0.24
251 0.26
252 0.25
253 0.25
254 0.23
255 0.21
256 0.22
257 0.2
258 0.17
259 0.2
260 0.18
261 0.17
262 0.17
263 0.18
264 0.18
265 0.19
266 0.22
267 0.18
268 0.19
269 0.19
270 0.2
271 0.18
272 0.16
273 0.14
274 0.11
275 0.1
276 0.09
277 0.08
278 0.06
279 0.06
280 0.05
281 0.04
282 0.03
283 0.03
284 0.04
285 0.04
286 0.05
287 0.07
288 0.09
289 0.11
290 0.16
291 0.21
292 0.22
293 0.23
294 0.24
295 0.25
296 0.25
297 0.25
298 0.21
299 0.16
300 0.15
301 0.13
302 0.11
303 0.08