Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427YM91

Protein Details
Accession A0A427YM91    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-83NDPAERERLKKERKERKRKEREREENEERERBasic
NLS Segment(s)
PositionSequence
58-75RERLKKERKERKRKERER
Subcellular Location(s) mito 15, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MPSKPPSATYPSNLLSLITSSTYPVTPTLEELEALRVALQQQVSSNAIRLAENDPAERERLKKERKERKRKEREREENEERERAALEANERAGQRLEAIERARTGSASVALGTPGKQGSPAGVRIKRDRTSSECSALARQTTSYRPDPHCRGLRFALGPPMPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.21
4 0.18
5 0.13
6 0.11
7 0.11
8 0.12
9 0.12
10 0.12
11 0.12
12 0.13
13 0.12
14 0.14
15 0.16
16 0.15
17 0.15
18 0.14
19 0.16
20 0.13
21 0.13
22 0.11
23 0.09
24 0.09
25 0.11
26 0.1
27 0.09
28 0.1
29 0.12
30 0.14
31 0.14
32 0.14
33 0.13
34 0.13
35 0.13
36 0.14
37 0.13
38 0.15
39 0.16
40 0.16
41 0.16
42 0.17
43 0.18
44 0.18
45 0.18
46 0.21
47 0.29
48 0.37
49 0.43
50 0.53
51 0.62
52 0.72
53 0.81
54 0.86
55 0.88
56 0.91
57 0.93
58 0.94
59 0.94
60 0.94
61 0.9
62 0.89
63 0.85
64 0.82
65 0.74
66 0.65
67 0.53
68 0.43
69 0.35
70 0.25
71 0.18
72 0.11
73 0.09
74 0.09
75 0.09
76 0.12
77 0.11
78 0.12
79 0.12
80 0.11
81 0.1
82 0.1
83 0.1
84 0.11
85 0.12
86 0.13
87 0.13
88 0.14
89 0.14
90 0.13
91 0.12
92 0.09
93 0.09
94 0.08
95 0.08
96 0.07
97 0.07
98 0.08
99 0.08
100 0.08
101 0.08
102 0.07
103 0.07
104 0.07
105 0.09
106 0.12
107 0.18
108 0.25
109 0.28
110 0.33
111 0.39
112 0.47
113 0.48
114 0.49
115 0.49
116 0.46
117 0.51
118 0.51
119 0.49
120 0.43
121 0.41
122 0.41
123 0.37
124 0.33
125 0.26
126 0.23
127 0.23
128 0.26
129 0.3
130 0.33
131 0.39
132 0.44
133 0.52
134 0.57
135 0.63
136 0.67
137 0.64
138 0.63
139 0.59
140 0.6
141 0.53
142 0.5
143 0.49