Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A427YWS7

Protein Details
Accession A0A427YWS7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
148-176VLRHDLKKIKEDQKKIKEDQKKIKAKEGNBasic
NLS Segment(s)
PositionSequence
157-172KEDQKKIKEDQKKIKA
Subcellular Location(s) nucl 8, cyto_nucl 7, cyto 4, extr 4, vacu 4, mito 3, plas 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
IPR000772  Ricin_B_lectin  
Pfam View protein in Pfam  
PF00652  Ricin_B_lectin  
PROSITE View protein in PROSITE  
PS50231  RICIN_B_LECTIN  
CDD cd00161  RICIN  
Amino Acid Sequences MRGQTKFVLAGTNFCLDATQQNPPNGIKMKIWECFVDLPQQDWFYTDDNRIALTNQGECLDLTNGNLTNFNPLQVWACTTGNTNHNVVSPCAAQAEIPSIGVSQIVPLMLPTPEQQQTVHCSQVARPDASRPVDLGSHMLAEDPLQGVLRHDLKKIKEDQKKIKEDQKKIKAKEGNSEEIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.14
4 0.19
5 0.19
6 0.24
7 0.27
8 0.29
9 0.32
10 0.32
11 0.38
12 0.36
13 0.36
14 0.29
15 0.31
16 0.34
17 0.34
18 0.36
19 0.3
20 0.29
21 0.29
22 0.28
23 0.29
24 0.25
25 0.23
26 0.24
27 0.25
28 0.22
29 0.21
30 0.21
31 0.16
32 0.18
33 0.18
34 0.17
35 0.16
36 0.17
37 0.16
38 0.15
39 0.15
40 0.14
41 0.13
42 0.12
43 0.12
44 0.12
45 0.11
46 0.13
47 0.11
48 0.09
49 0.09
50 0.1
51 0.11
52 0.1
53 0.11
54 0.1
55 0.14
56 0.14
57 0.14
58 0.12
59 0.12
60 0.13
61 0.12
62 0.14
63 0.11
64 0.11
65 0.11
66 0.13
67 0.15
68 0.16
69 0.18
70 0.17
71 0.15
72 0.17
73 0.17
74 0.16
75 0.14
76 0.12
77 0.1
78 0.1
79 0.09
80 0.07
81 0.06
82 0.08
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.03
91 0.04
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.05
98 0.06
99 0.1
100 0.11
101 0.13
102 0.13
103 0.14
104 0.2
105 0.21
106 0.22
107 0.19
108 0.18
109 0.18
110 0.26
111 0.28
112 0.25
113 0.23
114 0.25
115 0.3
116 0.32
117 0.31
118 0.23
119 0.21
120 0.2
121 0.2
122 0.18
123 0.13
124 0.11
125 0.1
126 0.1
127 0.08
128 0.07
129 0.08
130 0.07
131 0.06
132 0.07
133 0.07
134 0.08
135 0.14
136 0.2
137 0.21
138 0.24
139 0.3
140 0.32
141 0.39
142 0.47
143 0.52
144 0.55
145 0.63
146 0.71
147 0.75
148 0.81
149 0.81
150 0.82
151 0.82
152 0.83
153 0.84
154 0.84
155 0.83
156 0.79
157 0.82
158 0.79
159 0.72
160 0.72
161 0.69