Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A427YVN1

Protein Details
Accession A0A427YVN1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
264-295DAEIEKRSERDKKKEGRRRKEEERRAKAEARSBasic
NLS Segment(s)
PositionSequence
151-163ARASEAKARLRRK
269-295KRSERDKKKEGRRRKEEERRAKAEARS
Subcellular Location(s) mito 20, mito_nucl 12.666, cyto_mito 12.166, cyto_nucl 4.166, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR001288  Translation_initiation_fac_3  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MLSRTIRAGTTNLSQQPVVFLRCKAPATSQHVAGPSTSVAHRAFRSLTPLLFPPPSRGGPSFSRGSGPSDASAPPPNPLTLRDAAIPFRTVRLVSSEDNSLGPPTPLRSILRSYDPSTHTLAIVSIPNDSGSDLPIPIVKLLNREEERLKARASEAKARLRRKINAENKEVQVSWSSAEGDLRHKAILAKGILEKGDQVELVFAPRSKEKIDDRRKDEIVASFKDVLDDVGSQWKEDLVNKGTRVCYWAPKASVRSEIRQKVTDAEIEKRSERDKKKEGRRRKEEERRAKAEARSAGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.33
4 0.33
5 0.32
6 0.27
7 0.26
8 0.27
9 0.32
10 0.34
11 0.3
12 0.32
13 0.37
14 0.42
15 0.45
16 0.43
17 0.42
18 0.42
19 0.41
20 0.35
21 0.28
22 0.2
23 0.18
24 0.16
25 0.17
26 0.16
27 0.2
28 0.2
29 0.22
30 0.24
31 0.22
32 0.28
33 0.26
34 0.25
35 0.24
36 0.25
37 0.26
38 0.27
39 0.27
40 0.26
41 0.29
42 0.3
43 0.32
44 0.31
45 0.32
46 0.32
47 0.37
48 0.34
49 0.3
50 0.31
51 0.27
52 0.3
53 0.28
54 0.26
55 0.21
56 0.21
57 0.2
58 0.21
59 0.24
60 0.2
61 0.19
62 0.19
63 0.19
64 0.18
65 0.2
66 0.22
67 0.19
68 0.2
69 0.2
70 0.21
71 0.22
72 0.22
73 0.22
74 0.17
75 0.16
76 0.16
77 0.14
78 0.13
79 0.14
80 0.17
81 0.16
82 0.18
83 0.18
84 0.18
85 0.18
86 0.18
87 0.15
88 0.12
89 0.11
90 0.09
91 0.1
92 0.11
93 0.13
94 0.14
95 0.16
96 0.18
97 0.21
98 0.25
99 0.27
100 0.28
101 0.31
102 0.31
103 0.31
104 0.31
105 0.28
106 0.23
107 0.2
108 0.17
109 0.13
110 0.12
111 0.1
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.07
124 0.07
125 0.08
126 0.08
127 0.1
128 0.12
129 0.19
130 0.19
131 0.21
132 0.22
133 0.25
134 0.28
135 0.26
136 0.25
137 0.18
138 0.19
139 0.22
140 0.23
141 0.28
142 0.3
143 0.37
144 0.44
145 0.47
146 0.52
147 0.53
148 0.55
149 0.54
150 0.59
151 0.6
152 0.6
153 0.62
154 0.6
155 0.56
156 0.53
157 0.46
158 0.36
159 0.28
160 0.21
161 0.16
162 0.12
163 0.11
164 0.09
165 0.1
166 0.1
167 0.12
168 0.13
169 0.13
170 0.12
171 0.12
172 0.13
173 0.13
174 0.17
175 0.14
176 0.14
177 0.15
178 0.16
179 0.16
180 0.15
181 0.14
182 0.1
183 0.11
184 0.08
185 0.07
186 0.07
187 0.07
188 0.08
189 0.09
190 0.09
191 0.1
192 0.12
193 0.14
194 0.14
195 0.2
196 0.27
197 0.37
198 0.47
199 0.55
200 0.6
201 0.65
202 0.65
203 0.61
204 0.56
205 0.51
206 0.46
207 0.39
208 0.37
209 0.31
210 0.3
211 0.28
212 0.25
213 0.19
214 0.14
215 0.12
216 0.09
217 0.16
218 0.16
219 0.15
220 0.15
221 0.16
222 0.16
223 0.18
224 0.23
225 0.2
226 0.26
227 0.27
228 0.31
229 0.31
230 0.3
231 0.32
232 0.29
233 0.32
234 0.33
235 0.37
236 0.37
237 0.42
238 0.45
239 0.43
240 0.5
241 0.46
242 0.49
243 0.53
244 0.57
245 0.57
246 0.56
247 0.54
248 0.48
249 0.47
250 0.44
251 0.38
252 0.36
253 0.36
254 0.38
255 0.39
256 0.38
257 0.43
258 0.47
259 0.52
260 0.56
261 0.61
262 0.67
263 0.77
264 0.84
265 0.88
266 0.89
267 0.91
268 0.91
269 0.92
270 0.93
271 0.93
272 0.93
273 0.92
274 0.88
275 0.84
276 0.82
277 0.75
278 0.72