Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VD38

Protein Details
Accession K1VD38   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-43STYPPWFSLSQRKKKPRQEQDTPRYRKRKDMISAPQPSSHydrophilic
290-311SHTHTHEHRRKTVKPRVPPAIPBasic
NLS Segment(s)
PositionSequence
17-21KKKPR
Subcellular Location(s) nucl 13, mito 10, cyto_nucl 9, cyto 3
Family & Domain DBs
Amino Acid Sequences MPPFSTYPPWFSLSQRKKKPRQEQDTPRYRKRKDMISAPQPSSLPLLFATDSVGHVKTQWGTSLAEQSAHQHAPLPTPRQTPRQTPDKVTPAQPPVVNGKSYGTLVGGRKRKPVLKLNTDESEWHPPQSPFDPRPPSSGCSSPASARDLPLSEASQRRRSPPARLSPRSNSRTPSGSSSSQNSPPVPPRPQRRIVSVSAGPPSYIPPPSTFSSLGPRPISAFPVSSRPAAGLAGRPTSLPADTADIYNFFLGNNVTRKRVDFHEISPRDMRDLATDARSNKRAFAGPAHSHTHTHEHRRKTVKPRVPPAIPPKPMMTTRQASNSPSSVDKVWFATKVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.71
4 0.78
5 0.87
6 0.93
7 0.93
8 0.92
9 0.92
10 0.93
11 0.93
12 0.94
13 0.92
14 0.91
15 0.9
16 0.83
17 0.82
18 0.77
19 0.76
20 0.74
21 0.75
22 0.75
23 0.75
24 0.81
25 0.73
26 0.7
27 0.6
28 0.53
29 0.46
30 0.35
31 0.26
32 0.17
33 0.18
34 0.14
35 0.14
36 0.15
37 0.12
38 0.14
39 0.15
40 0.15
41 0.12
42 0.13
43 0.15
44 0.15
45 0.15
46 0.16
47 0.15
48 0.16
49 0.18
50 0.23
51 0.21
52 0.2
53 0.19
54 0.21
55 0.24
56 0.23
57 0.21
58 0.2
59 0.21
60 0.26
61 0.32
62 0.34
63 0.34
64 0.41
65 0.45
66 0.49
67 0.53
68 0.55
69 0.56
70 0.6
71 0.59
72 0.58
73 0.62
74 0.6
75 0.59
76 0.54
77 0.54
78 0.48
79 0.48
80 0.42
81 0.37
82 0.36
83 0.36
84 0.32
85 0.26
86 0.23
87 0.21
88 0.2
89 0.18
90 0.12
91 0.14
92 0.17
93 0.24
94 0.29
95 0.3
96 0.35
97 0.39
98 0.43
99 0.46
100 0.52
101 0.53
102 0.56
103 0.6
104 0.6
105 0.58
106 0.54
107 0.49
108 0.43
109 0.43
110 0.34
111 0.3
112 0.28
113 0.26
114 0.28
115 0.31
116 0.34
117 0.28
118 0.36
119 0.41
120 0.38
121 0.44
122 0.43
123 0.4
124 0.37
125 0.37
126 0.31
127 0.27
128 0.28
129 0.24
130 0.24
131 0.26
132 0.23
133 0.21
134 0.19
135 0.17
136 0.17
137 0.17
138 0.15
139 0.14
140 0.2
141 0.23
142 0.3
143 0.3
144 0.32
145 0.39
146 0.41
147 0.45
148 0.47
149 0.54
150 0.56
151 0.59
152 0.62
153 0.62
154 0.69
155 0.66
156 0.6
157 0.52
158 0.45
159 0.43
160 0.39
161 0.35
162 0.3
163 0.28
164 0.28
165 0.29
166 0.3
167 0.3
168 0.31
169 0.27
170 0.26
171 0.28
172 0.32
173 0.35
174 0.39
175 0.44
176 0.49
177 0.56
178 0.56
179 0.57
180 0.55
181 0.51
182 0.49
183 0.43
184 0.38
185 0.32
186 0.3
187 0.24
188 0.19
189 0.19
190 0.15
191 0.14
192 0.13
193 0.13
194 0.17
195 0.18
196 0.21
197 0.21
198 0.2
199 0.25
200 0.26
201 0.3
202 0.26
203 0.25
204 0.24
205 0.24
206 0.25
207 0.19
208 0.19
209 0.15
210 0.2
211 0.22
212 0.19
213 0.19
214 0.16
215 0.16
216 0.15
217 0.15
218 0.13
219 0.13
220 0.14
221 0.14
222 0.14
223 0.14
224 0.15
225 0.14
226 0.11
227 0.09
228 0.12
229 0.12
230 0.13
231 0.12
232 0.12
233 0.13
234 0.12
235 0.11
236 0.07
237 0.08
238 0.08
239 0.12
240 0.18
241 0.19
242 0.22
243 0.23
244 0.25
245 0.27
246 0.31
247 0.33
248 0.29
249 0.32
250 0.4
251 0.41
252 0.44
253 0.45
254 0.42
255 0.38
256 0.35
257 0.31
258 0.23
259 0.25
260 0.23
261 0.23
262 0.27
263 0.28
264 0.34
265 0.39
266 0.36
267 0.35
268 0.35
269 0.34
270 0.32
271 0.35
272 0.37
273 0.37
274 0.42
275 0.45
276 0.43
277 0.42
278 0.42
279 0.45
280 0.44
281 0.5
282 0.52
283 0.55
284 0.62
285 0.69
286 0.75
287 0.76
288 0.8
289 0.78
290 0.8
291 0.82
292 0.83
293 0.79
294 0.8
295 0.79
296 0.79
297 0.73
298 0.66
299 0.6
300 0.57
301 0.56
302 0.51
303 0.49
304 0.44
305 0.44
306 0.49
307 0.49
308 0.46
309 0.48
310 0.45
311 0.4
312 0.37
313 0.36
314 0.31
315 0.29
316 0.28
317 0.28
318 0.29