Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VTM4

Protein Details
Accession K1VTM4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-86VPKRKVTHSRKSMRSANKHPKNKTKHTTBasic
NLS Segment(s)
PositionSequence
61-83KRKVTHSRKSMRSANKHPKNKTK
Subcellular Location(s) mito 12, extr 8, plas 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSAIARPLFSLRPRLTSALAFAPAAVAVGGFPVLGRLAAGVMGGLSSLLELLPPIVLAVPKRKVTHSRKSMRSANKHPKNKTKHTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.32
4 0.32
5 0.25
6 0.24
7 0.19
8 0.16
9 0.13
10 0.11
11 0.1
12 0.07
13 0.04
14 0.03
15 0.03
16 0.03
17 0.02
18 0.02
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.03
43 0.04
44 0.06
45 0.13
46 0.17
47 0.22
48 0.24
49 0.28
50 0.38
51 0.45
52 0.55
53 0.59
54 0.64
55 0.67
56 0.74
57 0.78
58 0.78
59 0.8
60 0.81
61 0.82
62 0.82
63 0.85
64 0.87
65 0.88
66 0.87