Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VQU9

Protein Details
Accession K1VQU9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
177-203AGAAPTKKEPKAKKPQKSNKPPTEEELHydrophilic
NLS Segment(s)
PositionSequence
182-196TKKEPKAKKPQKSNK
Subcellular Location(s) mito 15.5, cyto_mito 12.666, mito_nucl 10.499, cyto 7.5, cyto_nucl 6.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0006418  P:tRNA aminoacylation for protein translation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
Amino Acid Sequences MGYAKRAHLMNAMVPGLSGGKMSSSDAKSKIDFLDTPAEIKSKLKAALCTPGEVEGNGVLAFLKTVLIPVQELREEQARARGEERYKGEGSFAKADSPVGTLFSIPRPEKYGGDMHFSSYQALEDAYAKEELHPGDLKAGVTEALTSLLGPIRKVFDASPEWQEAEKLGYPNASVAAGAAPTKKEPKAKKPQKSNKPPTEEELIKLRAEKNQLYLKRHDLDTIPCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.16
4 0.13
5 0.1
6 0.06
7 0.07
8 0.08
9 0.1
10 0.17
11 0.19
12 0.24
13 0.26
14 0.3
15 0.3
16 0.31
17 0.3
18 0.27
19 0.25
20 0.23
21 0.28
22 0.25
23 0.26
24 0.24
25 0.24
26 0.21
27 0.22
28 0.21
29 0.17
30 0.21
31 0.22
32 0.24
33 0.26
34 0.34
35 0.34
36 0.33
37 0.29
38 0.27
39 0.25
40 0.22
41 0.2
42 0.11
43 0.1
44 0.09
45 0.08
46 0.06
47 0.05
48 0.05
49 0.04
50 0.04
51 0.03
52 0.04
53 0.05
54 0.05
55 0.06
56 0.07
57 0.09
58 0.09
59 0.1
60 0.11
61 0.14
62 0.15
63 0.15
64 0.21
65 0.2
66 0.21
67 0.22
68 0.26
69 0.24
70 0.3
71 0.33
72 0.31
73 0.31
74 0.29
75 0.3
76 0.27
77 0.28
78 0.25
79 0.22
80 0.17
81 0.17
82 0.17
83 0.15
84 0.13
85 0.1
86 0.08
87 0.08
88 0.07
89 0.08
90 0.1
91 0.15
92 0.14
93 0.15
94 0.18
95 0.19
96 0.19
97 0.21
98 0.24
99 0.2
100 0.24
101 0.23
102 0.22
103 0.22
104 0.21
105 0.19
106 0.14
107 0.13
108 0.08
109 0.08
110 0.06
111 0.06
112 0.06
113 0.07
114 0.08
115 0.08
116 0.08
117 0.1
118 0.1
119 0.11
120 0.11
121 0.1
122 0.1
123 0.11
124 0.11
125 0.09
126 0.09
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.04
134 0.05
135 0.07
136 0.07
137 0.08
138 0.08
139 0.1
140 0.1
141 0.12
142 0.11
143 0.14
144 0.18
145 0.2
146 0.23
147 0.22
148 0.23
149 0.22
150 0.22
151 0.18
152 0.17
153 0.17
154 0.14
155 0.14
156 0.13
157 0.13
158 0.13
159 0.13
160 0.1
161 0.07
162 0.06
163 0.06
164 0.06
165 0.07
166 0.08
167 0.09
168 0.12
169 0.17
170 0.21
171 0.29
172 0.36
173 0.46
174 0.57
175 0.66
176 0.74
177 0.8
178 0.87
179 0.9
180 0.94
181 0.94
182 0.92
183 0.9
184 0.84
185 0.77
186 0.75
187 0.66
188 0.58
189 0.54
190 0.47
191 0.39
192 0.39
193 0.36
194 0.32
195 0.36
196 0.35
197 0.35
198 0.42
199 0.48
200 0.5
201 0.54
202 0.57
203 0.56
204 0.55
205 0.51
206 0.45