Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433PNB6

Protein Details
Accession A0A433PNB6   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-116RLLLHHRHRSHRHRHRHRHRHRHRHRPRSRLHCCPRRSRRPHLLRPSLPBasic
NLS Segment(s)
PositionSequence
73-131HRHRSHRHRHRHRHRHRHRHRPRSRLHCCPRRSRRPHLLRPSLPHHHHLRLRLRPRKAP
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 5, cyto 4.5, extr 4
Family & Domain DBs
Amino Acid Sequences MKVFGVEIARIIFDFGEFVIKEGCRLIDHLLGGGGGRVIPLPRRHCHHLPRASPVRSAPPLVSYGTLRLLLHHRHRSHRHRHRHRHRHRHRHRPRSRLHCCPRRSRRPHLLRPSLPHHHHLRLRLRPRKAPLARPCFLLSPGSMNADSRAIKRCDLEHLLRQASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.1
4 0.1
5 0.11
6 0.14
7 0.14
8 0.14
9 0.15
10 0.16
11 0.12
12 0.13
13 0.16
14 0.15
15 0.15
16 0.15
17 0.14
18 0.13
19 0.12
20 0.1
21 0.07
22 0.04
23 0.04
24 0.05
25 0.06
26 0.11
27 0.18
28 0.24
29 0.29
30 0.35
31 0.43
32 0.5
33 0.57
34 0.62
35 0.64
36 0.61
37 0.66
38 0.69
39 0.63
40 0.58
41 0.51
42 0.48
43 0.4
44 0.38
45 0.29
46 0.22
47 0.21
48 0.2
49 0.19
50 0.13
51 0.13
52 0.12
53 0.13
54 0.11
55 0.12
56 0.15
57 0.2
58 0.27
59 0.34
60 0.36
61 0.43
62 0.52
63 0.6
64 0.67
65 0.72
66 0.75
67 0.78
68 0.87
69 0.9
70 0.92
71 0.94
72 0.94
73 0.95
74 0.95
75 0.94
76 0.94
77 0.94
78 0.94
79 0.91
80 0.9
81 0.88
82 0.87
83 0.85
84 0.84
85 0.84
86 0.81
87 0.79
88 0.8
89 0.82
90 0.82
91 0.82
92 0.81
93 0.82
94 0.83
95 0.87
96 0.87
97 0.86
98 0.8
99 0.78
100 0.76
101 0.74
102 0.67
103 0.62
104 0.57
105 0.55
106 0.54
107 0.56
108 0.58
109 0.58
110 0.66
111 0.69
112 0.7
113 0.7
114 0.72
115 0.75
116 0.73
117 0.73
118 0.73
119 0.73
120 0.67
121 0.64
122 0.6
123 0.51
124 0.45
125 0.37
126 0.27
127 0.23
128 0.23
129 0.23
130 0.21
131 0.2
132 0.2
133 0.22
134 0.23
135 0.21
136 0.27
137 0.26
138 0.28
139 0.3
140 0.31
141 0.34
142 0.4
143 0.43
144 0.43
145 0.49