Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A433P7L5

Protein Details
Accession A0A433P7L5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MNERRRSAHDPIPKKRRKVFFKIVTENKHGBasic
NLS Segment(s)
PositionSequence
11-18PIPKKRRK
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029000  Cyclophilin-like_dom_sf  
IPR020892  Cyclophilin-type_PPIase_CS  
IPR002130  Cyclophilin-type_PPIase_dom  
Gene Ontology GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0006457  P:protein folding  
GO:0000413  P:protein peptidyl-prolyl isomerization  
Pfam View protein in Pfam  
PF00160  Pro_isomerase  
PROSITE View protein in PROSITE  
PS00170  CSA_PPIASE_1  
PS50072  CSA_PPIASE_2  
Amino Acid Sequences MNERRRSAHDPIPKKRRKVFFKIVTENKHGDADNKPLGEPIVMELYDDIVPKTARNFFELCTHQNGFGYRGNKFHRVIPQFMIQGGDIVNGDGTGSISIYDELECTFYFFNVIPPPAPCLGPTFEDENFKLKHTGPGILSMANSDKVDTNGSQFFITTVKTPWLDGKNVVFGRVIEGWAYSRQKAMFRFPVFRPQYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.85
4 0.84
5 0.84
6 0.84
7 0.83
8 0.84
9 0.86
10 0.86
11 0.82
12 0.79
13 0.71
14 0.62
15 0.55
16 0.45
17 0.38
18 0.32
19 0.33
20 0.31
21 0.29
22 0.27
23 0.25
24 0.25
25 0.22
26 0.18
27 0.13
28 0.11
29 0.11
30 0.11
31 0.1
32 0.11
33 0.12
34 0.12
35 0.1
36 0.09
37 0.1
38 0.1
39 0.14
40 0.17
41 0.17
42 0.2
43 0.21
44 0.2
45 0.27
46 0.3
47 0.3
48 0.3
49 0.3
50 0.27
51 0.28
52 0.27
53 0.23
54 0.25
55 0.24
56 0.2
57 0.25
58 0.29
59 0.32
60 0.32
61 0.33
62 0.37
63 0.39
64 0.4
65 0.36
66 0.36
67 0.31
68 0.3
69 0.27
70 0.18
71 0.15
72 0.12
73 0.1
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.06
93 0.06
94 0.05
95 0.07
96 0.07
97 0.09
98 0.09
99 0.1
100 0.1
101 0.1
102 0.13
103 0.13
104 0.13
105 0.11
106 0.12
107 0.13
108 0.14
109 0.16
110 0.16
111 0.17
112 0.2
113 0.2
114 0.22
115 0.21
116 0.21
117 0.21
118 0.19
119 0.23
120 0.21
121 0.24
122 0.2
123 0.23
124 0.23
125 0.21
126 0.2
127 0.16
128 0.16
129 0.15
130 0.14
131 0.11
132 0.11
133 0.11
134 0.14
135 0.13
136 0.15
137 0.15
138 0.16
139 0.15
140 0.14
141 0.14
142 0.12
143 0.13
144 0.11
145 0.11
146 0.14
147 0.14
148 0.16
149 0.22
150 0.24
151 0.26
152 0.27
153 0.28
154 0.33
155 0.33
156 0.33
157 0.27
158 0.23
159 0.26
160 0.23
161 0.21
162 0.13
163 0.13
164 0.14
165 0.21
166 0.24
167 0.21
168 0.24
169 0.26
170 0.31
171 0.34
172 0.4
173 0.43
174 0.45
175 0.5
176 0.5
177 0.58